Catalog No: OPCA04233
Price: $0.00
SKU
OPCA04233
Availability: Domestic: Antibody & Kits: 2 weeks | Proteins: 4-6 weeks | International: Antibody & Kits: 2 weeks | Proteins: 4-6 weeks
Contact Us:
- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
Shipping Info:
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
PUTATIVE INVERTASE INHIBITOR Recombinant Protein (London plane tree) (OPCA04233)
Datasheets/Manuals | Printable datasheet for PUTATIVE INVERTASE INHIBITOR Recombinant Protein (London plane tree) (OPCA04233) (OPCA04233) |
---|
Predicted Species Reactivity | Platanus acerifolia |
---|---|
Product Format | Liquid or Lyophilized powder |
Additional Information | Species Specificity Detail: London plane tree |
Reconstitution and Storage | -20°C or -80°C |
Formulation | Tris-base, 50% glycerol |
Purity | Greater than 90% as determined by SDS-PAGE. |
Peptide Sequence | ADIVQGTCKKVAQRSPNVNYDFCVKSLGADPKSHTADLQGLGVISANLAIQHGSKIQTFIGRILKSKVDPALKKYLNDCVGLYADAKSSVQEAIADFKSKDYASANVKMSAALDDSVTCEDGFKEKKGIVSPVTKENKDYVQLTAISLAITKLLGA |
Protein Sequence | ADIVQGTCKKVAQRSPNVNYDFCVKSLGADPKSHTADLQGLGVISANLAIQHGSKIQTFIGRILKSKVDPALKKYLNDCVGLYADAKSSVQEAIADFKSKDYASANVKMSAALDDSVTCEDGFKEKKGIVSPVTKENKDYVQLTAISLAITKLLGA |
Storage Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Source | Yeast |
Protein Range | 24-179 aa |
Tag | N-terminal 6xHis-tagged |
Reference | The major Platanus acerifolia pollen allergen Pla a 1 has sequence homology to invertase inhibitors.Asturias J.A., Ibarrola I., Eraso E., Arilla M.C., Martinez A.Clin. Exp. Allergy 33:978-985(2003) |
---|---|
Alias Symbols | Pollen allergen Pla a 1. |
Protein Name | Putative invertase inhibitor |
Description of Target | Invertase inhibitor. |
Uniprot ID | Q8GT41 |
Protein Size (# AA) | Recombinant |
Molecular Weight | 18.6 kDa |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
Write Your Own Review