Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP40760_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP40760_P050-FITC Conjugated

ARP40760_P050-HRP Conjugated

ARP40760_P050-Biotin Conjugated

PUF60 Antibody - C-terminal region (ARP40760_P050)

Catalog#: ARP40760_P050
Domestic: within 1-2 days delivery | International: 1-2 days
Click here to learn more about Aviva's By-Request Conjugation Service.
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityCow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human PUF60
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology dataAnti-PUF60 (ARP40760_P050)
Peptide SequenceSynthetic peptide located within the following region: EIIVKIFVEFSIASETHKAIQALNGRWFAGRKVVAEVYDQERFDNSDLSA
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-PUF60 (ARP40760_P050) antibody is Catalog # AAP40760
Datasheets/ManualsPrintable datasheet for anti-PUF60 (ARP40760_P050) antibody
Sample Type Confirmation

PUF60 is supported by BioGPS gene expression data to be expressed in HeLa

Target ReferenceGao,J., (2008) Genomics 91 (4), 347-355
Gene SymbolPUF60
Official Gene Full NamePoly-U binding splicing factor 60KDa
Alias SymbolsFIR, FLJ31379, RoBPI, SIAHBP1
NCBI Gene Id22827
Protein NamePoly(U)-binding-splicing factor PUF60
Description of TargetPUF60 is a Ro RNP-binding protein. It interacts with Ro RNPs and their interaction is thought to represent a gain of function for Ro RNPs. This protein also forms a ternary complex with far upstream element (FUSE) and FUSE-binding protein. It can repress a c-myc reporter via the FUSE. It is also known to target transcription factor IIH and inhibit activated transcription.The protein encoded by this gene is a Ro RNP-binding protein. It interacts with Ro RNPs and their interaction is thought to represent a gain of function for Ro RNPs. This protein also forms a ternary complex with far upstream element (FUSE) and FUSE-binding protein. It can repress a c-myc reporter via the FUSE. It is also known to target transcription factor IIH and inhibit activated transcription. This gene is implicated in the xeroderma pigmentosum disorder. There are two alternatively spliced transcript variants of this gene encoding different isoforms. There seems to be evidence of multiple polyadenylation sites for this gene.The protein encoded by this gene is a Ro RNP-binding protein. It interacts with Ro RNPs and their interaction is thought to represent a gain of function for Ro RNPs. This protein also forms a ternary complex with far upstream element (FUSE) and FUSE-binding protein. It can repress a c-myc reporter via the FUSE. It is also known to target transcription factor IIH and inhibit activated transcription. This gene is implicated in the xeroderma pigmentosum disorder. There are two alternatively spliced transcript variants of this gene encoding different isoforms. There seems to be evidence of multiple polyadenylation sites for this gene.
Swissprot IdQ9UHX1-2
Protein Accession #NP_055096
Nucleotide Accession #NM_014281
Protein Size (# AA)542
Molecular Weight58kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express PUF60.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express PUF60.
Protein InteractionsZG16; ARL8A; LOH12CR1; KIAA1683; MED28; QRICH1; UBE2I; SIAH1; SRSF11; SAP30BP; UPF2; KIAA0907; PUF60; U2AF2; SDCBP; RAD23B; CCNC; SUMO2; SUMO3; CDKN1A; UBC; ERG; EED; H3F3A; FAM129B; VPS29; FAF1; PAPOLA; NUDC; HIRIP3; ZYX; UGP2; TARS; TROVE2; PPM1G; PPP1R
  1. What is the species homology for "PUF60 Antibody - C-terminal region (ARP40760_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish".

  2. How long will it take to receive "PUF60 Antibody - C-terminal region (ARP40760_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "PUF60 Antibody - C-terminal region (ARP40760_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "PUF60 Antibody - C-terminal region (ARP40760_P050)"?

    This target may also be called "FIR, FLJ31379, RoBPI, SIAHBP1" in publications.

  5. What is the shipping cost for "PUF60 Antibody - C-terminal region (ARP40760_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "PUF60 Antibody - C-terminal region (ARP40760_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "PUF60 Antibody - C-terminal region (ARP40760_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "58kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "PUF60 Antibody - C-terminal region (ARP40760_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "PUF60"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "PUF60"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "PUF60"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "PUF60"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "PUF60"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "PUF60"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:PUF60 Antibody - C-terminal region (ARP40760_P050)
Your Rating
Free Microscope
Aviva Live Chat
Assay Development
Aviva ChIP Antibodies