PTPRZ1 Recombinant Protein (Human) (OPCA02772)

Catalog No: OPCA02772

PTPRZ1 Recombinant Protein (Human) (OPCA02772) in SDS-PAGE showing the molecular weight of approximately 32.1 kDa.

Product Info

• Predicted Species Reactivity: Homo sapiens|Human
• Product Format: Lyophilized 20mM Tris-HCl, 0.5M NaCl, 6% Trehalose
• Host: Human
• Reconstitution and Storage: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
• Purification: Affinity purified using IMAC
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: Partial Protein: IGWSYTGALNQKNWGKKYPTCNSPKQSPINIDEDLTQVNVNLKKLKFQGWDKTSLENTFIHNTGKTVEINLTNDYRVSGGVSEMVFKASKITFHWGKCNMSSDGSEHSLEGQKFPLEMQIYCFDADRFSSFEEAVKGKGKLRALSILFEVGTEENLDFKAIIDGVESVSRFGKQAALDPFILLNLLPNSTDKYYIYNGSLTSPPCTDTVDWIVFKDTVSISESQLAVFCEVLTMQQSGYVMLMDYLQNNFREQQYKFSRQVFSSY
• Source: Yeast
• Protein Range: 36-300 aa
• Tag: N-terminal 6xHis-tagged

Target Info

• Reference: A human transmembrane protein-tyrosine-phosphatase, PTP zeta, is expressed in brain and has an N-terminal receptor domain homologous to carbonic anhydrases.Krueger N.X., Saito H.Proc. Natl. Acad. Sci. U.S.A. 89:7417-7421(1992)
• Gene Symbol: PTPRZ1
• Gene Full Name: protein tyrosine phosphatase receptor type Z1
• Alias Symbols: HPTPZ;HPTPzeta;phosphacan;protein tyrosine phosphatase, receptor-type, Z polypeptide 1;protein tyrosine phosphatase, receptor-type, zeta polypeptide 1;Protein-tyrosine phosphatase receptor type Z polypeptide 1;protein-tyrosine phosphatase receptor type Z polypeptide 2;PTP18;PTPRZ;PTPZ;PTP-ZETA;receptor-type tyrosine phosphatase beta/zeta;receptor-type tyrosine-protein phosphatase zeta;RPTPB;RPTPbeta;R-PTP-zeta-2.
• NCBI Gene Id: 5803
• Protein Name: Receptor-type tyrosine-protein phosphatase zeta
• Description of Target: Protein tyrosine phosphatase that negatively regulates oligodendrocyte precursor proliferation in the embryonic spinal cord. Required for normal differentiation of the precursor cells into mature, fully myelinating oligodendrocytes. May play a role in protecting oligondendrocytes against apoptosis. May play a role in the establishment of contextual memory, probably via the dephosphorylation of proteins that are part of important signaling cascades (By similarity).
• Uniprot ID: P23471
• Protein Accession #: NP_001193767.1
  
• Nucleotide Accession #: NM_001206838.1
• Protein Size (# AA): Recombinant
• Molecular Weight: 32.1 kDa