Catalog No: ARP45366_P050
Price: $0.00
SKU
ARP45366_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-PTPRA (ARP45366_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human PTPRA
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Peptide SequenceSynthetic peptide located within the following region: SRQIRQFHFHGWPEVGIPSDGKGMISIIAAVQKQQQQSGNHPITVHCSAG
Concentration0.5 mg/ml
Blocking PeptideFor anti-PTPRA (ARP45366_P050) antibody is Catalog # AAP45366 (Previous Catalog # AAPP26339)
Sample Type Confirmation

PTPRA is supported by BioGPS gene expression data to be expressed in HEK293T

ReferenceZheng,X., (2008) Int. J. Cancer 122 (9), 1999-2007
Gene SymbolPTPRA
Gene Full NameProtein tyrosine phosphatase, receptor type, A
Alias SymbolsLRP, HLPR, PTPA, HEPTP, HPTPA, RPTPA, PTPRL2, HPTPalpha, R-PTP-alpha
NCBI Gene Id5786
Protein NameReceptor-type tyrosine-protein phosphatase alpha
Description of TargetPTPRA is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. PTPRA contains an extracellular domain, a single transmembrane segment and two tandem intracytoplasmic catalytic domains, and thus represents a receptor-type PTP. PTPRA has been shown to dephosphorylate and activate Src family tyrosine kinases, and is implicated in the regulation of integrin signaling, cell adhesion and proliferation. The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP contains an extracellular domain, a single transmembrane segment and two tandem intracytoplasmic catalytic domains, and thus represents a receptor-type PTP. This PTP has been shown to dephosphorylate and activate Src family tyrosine kinases, and is implicated in the regulation of integrin signaling, cell adhesion and proliferation. Three alternatively spliced variants of this gene, which encode two distinct isoforms, have been reported.
Uniprot IDP18433
Protein Accession #NP_002827
Nucleotide Accession #NM_002836
Protein Size (# AA)802
Molecular Weight89kDa
Protein InteractionsUBC; GRB2; CALM1; GABARAPL2; UVRAG; BCAR1; PTPRD; PTPRS; SRC; PTPRF; PRKCD; PTPRM; PTPRA; KCNA2; FYN;
  1. What is the species homology for "PTPRA Antibody - C-terminal region (ARP45366_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish".

  2. How long will it take to receive "PTPRA Antibody - C-terminal region (ARP45366_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "PTPRA Antibody - C-terminal region (ARP45366_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "PTPRA Antibody - C-terminal region (ARP45366_P050)"?

    This target may also be called "LRP, HLPR, PTPA, HEPTP, HPTPA, RPTPA, PTPRL2, HPTPalpha, R-PTP-alpha" in publications.

  5. What is the shipping cost for "PTPRA Antibody - C-terminal region (ARP45366_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "PTPRA Antibody - C-terminal region (ARP45366_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "PTPRA Antibody - C-terminal region (ARP45366_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "89kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "PTPRA Antibody - C-terminal region (ARP45366_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "PTPRA"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "PTPRA"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "PTPRA"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "PTPRA"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "PTPRA"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "PTPRA"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:PTPRA Antibody - C-terminal region (ARP45366_P050)
Your Rating
We found other products you might like!