PTPN21 Antibody - C-terminal region (ARP65819_P050)

Catalog No: ARP65819_P050

WB Suggested Anti-PTPN21 Antibody
Titration: 1.0 ug/ml
Positive Control: ACHN Whole Cell

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human PTPN21
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
• Peptide Sequence: Synthetic peptide located within the following region: FWQMVWEQGIAIIAMVTAEEEGGREKSFRYWPRLGSRHNTVTYGRFKITT
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-PTPN21 (ARP65819_P050) antibody is Catalog # AAP65819

Target Info

• Gene Symbol: PTPN21
• Alias Symbols: PTPD1, PTPRL10
• NCBI Gene Id: 11099
• Protein Name: Tyrosine-protein phosphatase non-receptor type 21
• Description of Target: The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP contains an N-terminal domain, similar to cytoskeletal- associated proteins including band 4.1, ezrin, merlin, and radixin. This PTP was shown to specially interact with BMX/ETK, a member of Tec tyrosine kinase family characterized by a multimodular structures including PH, SH3, and SH2 domains. The interaction of this PTP with BMX kinase was found to increase the activation of STAT3, but not STAT2 kinase. Studies of the similar gene in mice suggested the possible roles of this PTP in liver regeneration and spermatogenesis.
• Uniprot ID: Q16825
• Protein Accession #: NP_008970
• Nucleotide Accession #: NM_007039
• Protein Size (# AA): 1174
• Molecular Weight: 133kDa
• Protein Interactions: KIF1C; AKAP1; TEC; BMX; SRC;