Catalog No: ARP69998_P050-HRP
Size:100ul
Price: $434.00
SKU
ARP69998_P050-HRP
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

PTPN20A Antibody - middle region : HRP (ARP69998_P050-HRP)

Datasheets/ManualsPrintable datasheet for anti-PTPN20A (ARP69998_P050-HRP) antibody
Product Info
Predicted Species ReactivityHuman, Pig, Zebrafish
Product FormatLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
ClonalityPolyclonal
HostRabbit
ConjugationHRP: Horseradish Peroxidase
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of Human PTPN20A
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceHuman: 100%; Pig: 79%; Zebrafish: 77%
Peptide SequenceSynthetic peptide located within the following region: LEEKTAAYDIMQEFMALELKNLPGEFNSGNQPSNREKNRYRDILPYDSTR
Concentration0.5 mg/ml
Blocking PeptideFor anti-PTPN20A (ARP69998_P050-HRP) antibody is Catalog # AAP69998
Gene SymbolPTPN20A
Alias SymbolsCT126, PTPN20B, hPTPN20, bA142I17.1
NCBI Gene Id653129
Protein NameTyrosine-protein phosphatase non-receptor type 20
Description of TargetThe product of this gene belongs to the family of classical tyrosine-specific protein tyrosine phosphatases. Many protein tyrosine phosphatases have been shown to regulate fundamental cellular processes and several are mutated in human diseases. Chromosome 10q contains a segmental duplication resulting in multiple copies of the protein tyrosine phosphatase, non-receptor type 20 gene. The two nearly identical copies are designated as PTPN20A and PTPN20B. A third copy is only partially duplicated and contains a pseudogene, designated as PTPN20C. This gene encodes the more centromeric copy, PTPN20A. Multiple alternatively spliced transcript variants encoding different isoforms have been identified.
Uniprot IDQ4JDL3-4
Protein Size (# AA)339
Molecular Weight37kDa
  1. What is the species homology for "PTPN20A Antibody - middle region : HRP (ARP69998_P050-HRP)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Pig, Zebrafish".

  2. How long will it take to receive "PTPN20A Antibody - middle region : HRP (ARP69998_P050-HRP)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "PTPN20A Antibody - middle region : HRP (ARP69998_P050-HRP)" provided in?

    This item is provided in "Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "PTPN20A Antibody - middle region : HRP (ARP69998_P050-HRP)"?

    This target may also be called "CT126, PTPN20B, hPTPN20, bA142I17.1" in publications.

  5. What is the shipping cost for "PTPN20A Antibody - middle region : HRP (ARP69998_P050-HRP)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "PTPN20A Antibody - middle region : HRP (ARP69998_P050-HRP)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "PTPN20A Antibody - middle region : HRP (ARP69998_P050-HRP)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "37kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "PTPN20A Antibody - middle region : HRP (ARP69998_P050-HRP)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "PTPN20A"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "PTPN20A"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "PTPN20A"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "PTPN20A"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "PTPN20A"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "PTPN20A"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:PTPN20A Antibody - middle region : HRP (ARP69998_P050-HRP)
Your Rating