PTPN14 Antibody - middle region (ARP82018_P050)

Catalog No: ARP82018_P050

Host: Rabbit
Target Name: PTPN14
Sample Tissue: Human 786-0 Whole Cell lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PTPN14
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: PQGVYSNKLVSPSDQRNPKNNVVPSKPGASAISHTVSTPELANMQLQGSH
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-PTPN14 (ARP82018_P050) antibody is Catalog # AAP82018

Target Info

• Gene Symbol: PTPN14
• Gene Full Name: protein tyrosine phosphatase, non-receptor type 14
• Alias Symbols: PEZ, PTP36, PTPD2, CATLPH
• NCBI Gene Id: 5784
• Protein Name: tyrosine-protein phosphatase non-receptor type 14
• Description of Target: The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP contains an N-terminal noncatalytic domain similar to that of band 4.1 superfamily cytoskeleton-associated proteins, which suggested the membrane or cytoskeleton localization of this protein. It appears to regulate lymphatic development in mammals, and a loss of function mutation has been found in a kindred with a lymphedema-choanal atresia.
• Uniprot ID: Q15678
• Protein Accession #: NP_005392.2
• Nucleotide Accession #: NM_005401.4
• Protein Size (# AA): 1187
• Molecular Weight: 130 kDa