Now Offering Over 102,157 Antibodies & 44,722 Antigens!

PTOV1 antibody - N-terminal region (ARP50614_P050)

100 ul
$319.00
In Stock

Conjugation Options

ARP50614_P050-FITC Conjugated

ARP50614_P050-HRP Conjugated

ARP50614_P050-Biotin Conjugated

Gene Symbol:
PTOV1
NCBI Gene Id:
53635
Official Gene Full Name:
Prostate tumor overexpressed 1
Protein Name:
Prostate tumor-overexpressed gene 1 protein
Swissprot Id:
Q86YD1
Protein Accession #:
NP_059128
Nucleotide Accession #:
NM_017432
Alias Symbols:
DKFZP586I111, MGC71475, ACID2, PTOV-1
Replacement Item:
This antibody may replace item sc-152579 from Santa Cruz Biotechnology.
Description of Target:
PTOV1 belongs to the Mediator complex subunit 25 family, PTOV1 subfamily. It may activate transcription and is required for nuclear translocation of FLOT1. PTOV1 promotes cell proliferation.
Protein Size (# AA):
416
Molecular Weight:
47kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express PTOV1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express PTOV1.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human PTOV1
Species Reactivity:
Cow, Dog, Human, Mouse, Pig, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%
Complete computational species homology data:
Anti-PTOV1 (ARP50614_P050)
Peptide Sequence:
Synthetic peptide located within the following region: DSTAKLKRTLPCQAYVNQGENLETDQWPQKLIMQLIPQQLLTTLGPLFRN
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC; GNB2L1; FLOT1; RPS6; CUL2; USP16; HDAC6; CREBBP; BECN1; TMCC2; PIN1; SPTAN1; DMTN; SFN;
Blocking Peptide:
For anti-PTOV1 (ARP50614_P050) antibody is Catalog # AAP50614 (Previous Catalog # AAPS29312)
Datasheets/Manuals:
Printable datasheet for anti-PTOV1 (ARP50614_P050) antibody
Sample Type Confirmation:

PTOV1 is supported by BioGPS gene expression data to be expressed in Jurkat

Target Reference:
Santamaria,A., (2005) Mol. Cell. Biol. 25 (5), 1900-1911
Publications:

Youn, H.-S., Park, U.-H., Kim, E.-J. & Um, S.-J. PTOV1 antagonizes MED25 in RAR transcriptional activation. Biochem. Biophys. Res. Commun. 404, 239-44 (2011). IHC, WB, Cow, Dog, Human, Mouse, Pig, Rat 21110951

Tell us what you think about this item!

Write A Review
    Please, wait...