Search Antibody, Protein, and ELISA Kit Solutions

PTOV1 Antibody - N-terminal region (ARP50614_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP50614_P050-FITC Conjugated

ARP50614_P050-HRP Conjugated

ARP50614_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
Prostate tumor overexpressed 1
NCBI Gene Id:
Protein Name:
Prostate tumor-overexpressed gene 1 protein
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
DKFZP586I111, MGC71475, ACID2, PTOV-1
Replacement Item:
This antibody may replace item sc-152579 from Santa Cruz Biotechnology.
Description of Target:
PTOV1 belongs to the Mediator complex subunit 25 family, PTOV1 subfamily. It may activate transcription and is required for nuclear translocation of FLOT1. PTOV1 promotes cell proliferation.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express PTOV1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express PTOV1.
The immunogen is a synthetic peptide directed towards the N terminal region of human PTOV1
Predicted Species Reactivity:
Cow, Dog, Human, Mouse, Pig, Rat
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%
Complete computational species homology data:
Anti-PTOV1 (ARP50614_P050)
Peptide Sequence:
Synthetic peptide located within the following region: DSTAKLKRTLPCQAYVNQGENLETDQWPQKLIMQLIPQQLLTTLGPLFRN
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-PTOV1 (ARP50614_P050) antibody is Catalog # AAP50614 (Previous Catalog # AAPS29312)
Printable datasheet for anti-PTOV1 (ARP50614_P050) antibody
Sample Type Confirmation:

PTOV1 is supported by BioGPS gene expression data to be expressed in Jurkat

Target Reference:
Santamaria,A., (2005) Mol. Cell. Biol. 25 (5), 1900-1911

Youn, H.-S., Park, U.-H., Kim, E.-J. & Um, S.-J. PTOV1 antagonizes MED25 in RAR transcriptional activation. Biochem. Biophys. Res. Commun. 404, 239-44 (2011). IHC, WB, Cow, Dog, Human, Mouse, Pig, Rat 21110951

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...