Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP83893_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

PTK2 Antibody - middle region (ARP83893_P050)

Catalog#: ARP83893_P050
Domestic: within 24 hours delivery | International: 3-5 business days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human PTK2
PurificationAffinity purified
Peptide SequenceSynthetic peptide located within the following region: SWDSGGSDEAPPKPSRPGYPSPRSSEGFYPSPQHMVQTNHYQVSGYPGSH
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-PTK2 (ARP83893_P050) antibody is Catalog # AAP83893
Datasheets/ManualsPrintable datasheet for anti-PTK2 (ARP83893_P050) antibody
Gene SymbolPTK2
Official Gene Full Nameprotein tyrosine kinase 2
Alias SymbolsFAK, FADK, FAK1, FRNK, PPP1R71, p125FAK, pp125FAK
NCBI Gene Id5747
Protein Namefocal adhesion kinase 1
Description of TargetThis gene encodes a cytoplasmic protein tyrosine kinase which is found concentrated in the focal adhesions that form between cells growing in the presence of extracellular matrix constituents. The encoded protein is a member of the FAK subfamily of protein tyrosine kinases but lacks significant sequence similarity to kinases from other subfamilies. Activation of this gene may be an important early step in cell growth and intracellular signal transduction pathways triggered in response to certain neural peptides or to cell interactions with the extracellular matrix. Several transcript variants encoding different isoforms have been found for this gene, but the full-length natures of only four of them have been determined.
Swissprot IdQ05397
Protein Accession #NP_001186578.1
Nucleotide Accession #NM_001199649.1
Protein Size (# AA)1052
Molecular Weight115 kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express PTK2.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express PTK2.
Write Your Own Review
You're reviewing:PTK2 Antibody - middle region (ARP83893_P050)
Your Rating
Assay Development
Aviva Pathways
Aviva Live Chat
Aviva Validation Data