Search Antibody, Protein, and ELISA Kit Solutions

PTK2 Antibody - middle region (ARP83893_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Gene Symbol:
PTK2
Official Gene Full Name:
protein tyrosine kinase 2
NCBI Gene Id:
5747
Protein Name:
focal adhesion kinase 1
Swissprot Id:
Q05397
Protein Accession #:
NP_001186578.1
Nucleotide Accession #:
NM_001199649.1
Alias Symbols:
FAK, FADK, FAK1, FRNK, PPP1R71, p125FAK, pp125FAK
Description of Target:
This gene encodes a cytoplasmic protein tyrosine kinase which is found concentrated in the focal adhesions that form between cells growing in the presence of extracellular matrix constituents. The encoded protein is a member of the FAK subfamily of protein tyrosine kinases but lacks significant sequence similarity to kinases from other subfamilies. Activation of this gene may be an important early step in cell growth and intracellular signal transduction pathways triggered in response to certain neural peptides or to cell interactions with the extracellular matrix. Several transcript variants encoding different isoforms have been found for this gene, but the full-length natures of only four of them have been determined.
Protein Size (# AA):
1052
Molecular Weight:
115 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express PTK2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express PTK2.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human PTK2
Predicted Species Reactivity:
Human
Tested Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: SWDSGGSDEAPPKPSRPGYPSPRSSEGFYPSPQHMVQTNHYQVSGYPGSH
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-PTK2 (ARP83893_P050) antibody is Catalog # AAP83893
Datasheets/Manuals:
Printable datasheet for anti-PTK2 (ARP83893_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...