PTH2 Antibody - middle region (ARP53357_P050)

Catalog No: ARP53357_P050

WB Suggested Anti-PTH2 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PTH2
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: WADPATPRPRRSLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-PTH2 (ARP53357_P050) antibody is Catalog # AAP53357 (Previous Catalog # AAPP30940)
• Reference: Bisello,A., (2004) Mol. Endocrinol. 18 (6), 1486-1498

Target Info

• Gene Symbol: PTH2
• Gene Full Name: Parathyroid hormone 2
• Alias Symbols: TIP39
• NCBI Gene Id: 113091
• Protein Name: Tuberoinfundibular peptide of 39 residues
• Description of Target: TIP39 is related to parathyroid hormone (PTH) and PTH-related protein (PTHRP) and is a ligand for PTH receptor-2.TIP39 is related to parathyroid hormone (PTH; MIM 168450) and PTH-related protein (PTHRP; MIM 168470) and is a ligand for PTH receptor-2 (PTHR2; MIM 601469) (John et al., 2002 [PubMed 11861531]).[supplied by OMIM].
• Uniprot ID: Q96A98
• Protein Accession #: NP_848544
• Nucleotide Accession #: NM_178449
• Protein Size (# AA): 100
• Molecular Weight: 11kDa
• Protein Interactions: PTH2; PTH2R;