PTH Recombinant Protein (Pig) (OPCA03665)

Catalog No: OPCA03665

Product Info

• Predicted Species Reactivity: Porcine|Sus scrofa
• Product Format: Liquid or Lyophilized powder
• Host: Pig
• Additional Information: Relevance: Cell surface proteoglycan that bears heparan sulfate. Inhibits the dipeptidyl peptidase activity of DPP4. May be involved in the suppression/modulation of growth in the predominantly mesodermal tissues and organs. May play a role in the modulation of IGF2 interactions with its receptor and thereby modulate its function. May regulate growth and tumor predisposition (By similarity).
• Reconstitution and Storage: -20°C or -80°C
• Formulation: 20 mM Tris-HCl based buffer, pH 8.0
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: MTKEEQIFLLHRAQAQCEKRLKEVLQRPADIMESDKGWASAPTSGKPRKEKASGKLYPESGEDTGSRHQGRPCLPEWDHILCWP
• Protein Sequence: MTKEEQIFLLHRAQAQCEKRLKEVLQRPADIMESDKGWASAPTSGKPRKEKASGKLYPESGEDTGSRHQGRPCLPEWDHILCWP
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Mammalian Cells
• Protein Range: 32-115 aa
• Tag: N-terminal 6xHis-tagged

Target Info

• Reference: Mapping of chimpanzee full-length cDNAs onto the human genome unveils large potential divergence of the transcriptome.Sakate R., Suto Y., Imanishi T., Tanoue T., Hida M., Hayasaka I., Kusuda J., Gojobori T., Hashimoto K., Hirai M.Gene 399:1-10(2007)
• Gene Symbol: PTH1R
• Gene Full Name: parathyroid hormone 1 receptor
• Alias Symbols: Parathyroid hormone 1 receptor, parathyroid hormone receptor 1, parathyroid hormone/parathyroid hormone-related peptide receptor, parathyroid receptor, PTH, PTH/PTHr receptor, PTH/PTHrP type I receptor, PTH1 receptor, PTHR1.
• NCBI Gene Id: 397675
• Protein Name: Parathyroid hormone/parathyroid hormone-related peptide receptor
• Description of Target: Receptor for parathyroid hormone and for parathyroid hormone-related peptide. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase and also a phosphatidylinositol-calcium second messenger system.
• Uniprot ID: P50133
• Protein Accession #: NP_999547.1
  
• Nucleotide Accession #: NM_214382.1
• Protein Size (# AA): Full Length of Mature Protein
• Molecular Weight: 13.6 kDa