PTCH2 Antibody - N-terminal region (ARP45522_P050)

Catalog No: ARP45522_P050

WB Suggested Anti-PTCH2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Placenta

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PTCH2
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 79%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 86%; Rat: 93%
• Peptide Sequence: Synthetic peptide located within the following region: LAQEALPENASQQIHAFSSTTLDDILHAFSEVSAARVVGGYLLMLAYACV
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-PTCH2 (ARP45522_P050) antibody is Catalog # AAP45522 (Previous Catalog # AAPP26919)
• Reference: Gregory,S.G., (2006) Nature 441 (7091), 315-321

Target Info

• Gene Symbol: PTCH2
• Gene Full Name: Patched 2
• Alias Symbols: PTC2
• NCBI Gene Id: 8643
• Protein Name: Protein patched homolog 2
• Description of Target: PTCH2 is a member of the patched protein family. The patched protein is the receptor for sonic hedgehog, a secreted molecule implicated in the formation of embryonic structures and in tumorigenesis. The gene encoding PTCH2 is shown to be mutated in a medulloblastoma and in a basal cell carcinoma, suggesting that it plays a role in the development of some tumors. This gene encodes a member of the patched gene family. The patched protein is the receptor for sonic hedgehog, a secreted molecule implicated in the formation of embryonic structures and in tumorigenesis. This gene is shown to be mutated in a medulloblastoma and in a basal cell carcinoma, suggesting that it plays a role in the development of some tumors. Alternative transcript variants have been described, but their biological function has not been determined. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-10 AF119569.1 1-10 11-534 AY359016.1 3-526 535-2066 AF087651.1 523-2054 2067-2509 AF119569.1 2067-2509 2510-2520 AF087651.1 2498-2508 2521-2700 AF119569.1 2521-2700 2701-3620 AY358555.1 2689-3608 3621-3624 AF087651.1 3609-3612
• Uniprot ID: Q9Y6C5
• Protein Accession #: NP_003729
• Nucleotide Accession #: NM_003738
• Protein Size (# AA): 1203
• Molecular Weight: 130kDa
• Protein Interactions: ARRB1; DHH; SMO; IHH; SHH;