PTCH1 Antibody (OAAL00266)

Catalog No: OAAL00266

Size:100UG

Detection limit for recombinant GST tagged PTCH is approximately 0.1ng/ml as a capture antibody.

Product Info

• Predicted Species Reactivity: Human, Mouse
• Product Format: Liquid
• Clonality: Monoclonal
• Clone: 8E1
• Isotype: IgG2a Kappa
• Host: Mouse
• Application: Enzyme-linked immunosorbent assay|Western blot
• Reconstitution and Storage: Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
• Immunogen: PTCH (NP_000255, 841 a.a. ~ 940 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Peptide Sequence: PKMWLHYFRDWLQGLQDAFDSDWETGKIMPNNYKNGSDDGVLAYKLLVQTGSRDKPIDISQLTKQRLVDADGIINPSAFYIYLTAWVSNDPVAYAASQAN
• Formulation: In 1x PBS, pH 7.4

Target Info

• Gene Symbol: PTCH1
• Gene Full Name: patched 1
• Alias Symbols: BCNS;NBCCS;protein patched homolog 1;PTC;PTC1;PTCH.
• NCBI Gene Id: 5727
• Protein Name: Homo sapiens patched 1 (PTCH1), transcript variant 1b, mRNA|protein patched homolog 1 isoform L [Homo sapiens]
• Description of Target: This gene encodes a member of the patched gene family. The encoded protein is the receptor for sonic hedgehog, a secreted molecule implicated in the formation of embryonic structures and in tumorigenesis, as well as the desert hedgehog and indian hedgehog proteins. This gene functions as a tumor suppressor. Mutations of this gene have been associated with basal cell nevus syndrome, esophageal squamous cell carcinoma, trichoepitheliomas, transitional cell carcinomas of the bladder, as well as holoprosencephaly. Alternative splicing results in multiple transcript variants encoding different isoforms. Additional splice variants have been described, but their full length sequences and biological validity cannot be determined currently. [provided by RefSeq
• Protein Accession #: https://www.ncbi.nlm.nih.gov/protein/NP_000255
• Nucleotide Accession #: https://www.ncbi.nlm.nih.gov/nuccore/NM_000264