PTCH1 Antibody - C-terminal region (ARP44249_P050)

Catalog No: ARP44249_P050

WB Suggested Anti-PTCH1 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate

Kidney

Rabbit Anti-PTCH1 Antibody
Catalog Number: ARP44249_P050
Formalin Fixed Paraffin Embedded Tissue: Human Testis Tissue
Observed Staining: Plasma membrane
Primary Antibody Concentration: 1:600
Other Working Concentrations: N/A
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 - 2.0 sec

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IHC, WB
• Additional Information: IHC Information: Paraffin embedded kidney tissue, tested with an antibody dilution of 5 ug/ml.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human PTCH1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 79%
• Peptide Sequence: Synthetic peptide located within the following region: TILGVLNGLVLLPVLLSFFGPYPEVSPANGLNRLPTPSPEPPPSVVRFAM
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-PTCH1 (ARP44249_P050) antibody is Catalog # AAP44249 (Previous Catalog # AAPP25629)
• Publications:

  Antagonizing the Hedgehog Pathway with Vismodegib Impairs Malignant Pleural Mesothelioma Growth In Vivo by Affecting Stroma. Mol. Cancer Ther. 15, 1095-105 (2016). 26839306

  Impaired response of the bronchial epithelium to inflammation characterizes severe equine asthma. BMC Genomics. 18, 708 (2017). 28886691

• Description:
  View product citations for PTCH1 Antibody - C-terminal region (ARP44249_P050) on CiteAb

Target Info

• Gene Symbol: PTCH1
• Gene Full Name: Patched 1
• Alias Symbols: PTC, BCNS, PTC1, PTCH, NBCCS
• NCBI Gene Id: 5727
• Protein Name: Patched EMBL AAR21240.1
• Description of Target: PTCH1 is a member of the patched gene family. The protein is the receptor for sonic hedgehog, a secreted molecule implicated in the formation of embryonic structures and in tumorigenesis. It functions as a tumor suppressor. Mutations of its gene have been associated with nevoid basal cell carcinoma syndrome, esophageal squamous cell carcinoma, trichoepitheliomas, transitional cell carcinomas of the bladder, as well as holoprosencephaly.
• Uniprot ID: Q6TKP8
• Protein Accession #: AAR21240
• Nucleotide Accession #: NM_000264
• Protein Size (# AA): 345
• Molecular Weight: 37kDa
• Protein Interactions: ITCH; SMURF2; SMURF1; NEDD4L; WWP2; WWP1; UBC; NEDD4; FHL2; CASP9; SMO; CAV1; HIPK2; DHH; IHH; SHH; CCNB1; CDK1;