Search Antibody, Protein, and ELISA Kit Solutions

Psmg2 Antibody - middle region (ARP67762_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP67762_P050-FITC Conjugated

ARP67762_P050-HRP Conjugated

ARP67762_P050-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Dog, Goat, Guinea Pig, Human, Mouse, Rabbit, Rat, Sheep
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
proteasome (prosome, macropain) assembly chaperone 2
NCBI Gene Id:
Protein Name:
Proteasome assembly chaperone 2
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
1700017I17Rik, AW545363, Clast3, Tnfsf5ip1
Replacement Item:
This antibody may replace item sc-152564 from Santa Cruz Biotechnology.
Description of Target:
Psmg2 is a chaperone protein which promotes assembly of the 20S proteasome as part of a heterodimer with PSMG1. The PSMG1-PSMG2 heterodimer binds to the PSMA5 and PSMA7 proteasome subunits, promotes assembly of the proteasome alpha subunits into the heteroheptameric alpha ring and prevents alpha ring dimerization.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express Psmg2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express Psmg2.
The immunogen is a synthetic peptide directed towards the middle region of Mouse Psmg2
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 83%; Goat: 86%; Guinea Pig: 92%; Human: 100%; Mouse: 92%; Rabbit: 93%; Rat: 92%; Sheep: 92%
Peptide Sequence:
Synthetic peptide located within the following region: YLLTPCLQKSVQNKIKSLNWLEMEKSRCIPEMSDSEFCIRIPGGGITKTL
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-Psmg2 (ARP67762_P050) antibody is Catalog # AAP67762
Printable datasheet for anti-Psmg2 (ARP67762_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...