Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP67762_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP67762_P050-FITC Conjugated

ARP67762_P050-HRP Conjugated

ARP67762_P050-Biotin Conjugated

Psmg2 Antibody - middle region (ARP67762_P050)

Catalog#: ARP67762_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Mouse
Predicted Species Reactivity Cow, Dog, Goat, Guinea Pig, Human, Mouse, Rabbit, Rat, Sheep
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-152564 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of Mouse Psmg2
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 83%; Goat: 86%; Guinea Pig: 92%; Human: 100%; Mouse: 92%; Rabbit: 93%; Rat: 92%; Sheep: 92%
Peptide Sequence Synthetic peptide located within the following region: YLLTPCLQKSVQNKIKSLNWLEMEKSRCIPEMSDSEFCIRIPGGGITKTL
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-Psmg2 (ARP67762_P050) antibody is Catalog # AAP67762
Datasheets/Manuals Printable datasheet for anti-Psmg2 (ARP67762_P050) antibody
Gene Symbol Psmg2
Official Gene Full Name proteasome (prosome, macropain) assembly chaperone 2
Alias Symbols 1700017I17Rik, AW545363, Clast3, Tnfsf5ip1
NCBI Gene Id 107047
Protein Name Proteasome assembly chaperone 2
Description of Target Psmg2 is a chaperone protein which promotes assembly of the 20S proteasome as part of a heterodimer with PSMG1. The PSMG1-PSMG2 heterodimer binds to the PSMA5 and PSMA7 proteasome subunits, promotes assembly of the proteasome alpha subunits into the heteroheptameric alpha ring and prevents alpha ring dimerization.
Swissprot Id Q9EST4
Protein Accession # NP_598899
Nucleotide Accession # NM_134138
Protein Size (# AA) 264
Molecular Weight 29kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express Psmg2.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express Psmg2.
Protein Interactions Eed;
  1. What is the species homology for "Psmg2 Antibody - middle region (ARP67762_P050)"?

    The tested species reactivity for this item is "Mouse". This antibody is predicted to have homology to "Cow, Dog, Goat, Guinea Pig, Human, Mouse, Rabbit, Rat, Sheep".

  2. How long will it take to receive "Psmg2 Antibody - middle region (ARP67762_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "Psmg2 Antibody - middle region (ARP67762_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "Psmg2 Antibody - middle region (ARP67762_P050)"?

    This target may also be called "1700017I17Rik, AW545363, Clast3, Tnfsf5ip1" in publications.

  5. What is the shipping cost for "Psmg2 Antibody - middle region (ARP67762_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "Psmg2 Antibody - middle region (ARP67762_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "Psmg2 Antibody - middle region (ARP67762_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "29kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "Psmg2 Antibody - middle region (ARP67762_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "PSMG2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "PSMG2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "PSMG2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "PSMG2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "PSMG2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "PSMG2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:Psmg2 Antibody - middle region (ARP67762_P050)
Your Rating