PSME4 Antibody - C-terminal region (ARP86240_P050)

Catalog No: ARP86240_P050

Host: Rabbit
Target Name: PSME4
Sample Tissue: Human HCT116 Whole Cell lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human PSME4
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: WMPQLLMNLSAHLNDPQPIEMTVKKTLSNFRRTHHDNWQEHKQQFTDDQL
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-PSME4 (ARP86240_P050) antibody is Catalog # AAP86240

Target Info

• Gene Symbol: PSME4
• Gene Full Name: proteasome activator subunit 4
• Alias Symbols: PA200
• NCBI Gene Id: 23198
• Protein Name: proteasome activator complex subunit 4
• Description of Target: Associated component of the proteasome that specifically recognizes acetylated histones and promotes ATP- and ubiquitin-independent degradation of core histones during spermatogenesis and DNA damage response. Recognizes and binds acetylated histones via its bromodomain-like (BRDL) region and activates the proteasome by opening the gated channel for substrate entry. Binds to the core proteasome via its C-terminus, which occupies the same binding sites as the proteasomal ATPases, opening the closed structure of the proteasome via an active gating mechanism. Component of the spermatoproteasome, a form of the proteasome specifically found in testis: binds to acetylated histones and promotes degradation of histones, thereby participating actively to the exchange of histones during spermatogenesis. Also involved in DNA damage response in somatic cells, by promoting degradation of histones following DNA double-strand breaks.
• Uniprot ID: Q14997-2
• Protein Accession #: NP_055429.2
• Nucleotide Accession #: NM_014614.2
• Protein Size (# AA): 1218
• Molecular Weight: 133 kDa