Search Antibody, Protein, and ELISA Kit Solutions

PSME2 Antibody - middle region (ARP56486_P050)

100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP56486_P050-FITC Conjugated

ARP56486_P050-HRP Conjugated

ARP56486_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-100799 from Santa Cruz Biotechnology.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human PSME2
Purification:
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 93%; Zebrafish: 86%
Complete computational species homology data:
Anti-PSME2 (ARP56486_P050)
Peptide Sequence:
Synthetic peptide located within the following region: SKETHVMDYRALVHERDEAAYGELRAMVLDLRAFYAELYHIISSNLEKIV
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-PSME2 (ARP56486_P050) antibody is Catalog # AAP56486 (Previous Catalog # AAPP38941)
Datasheets/Manuals:
Printable datasheet for anti-PSME2 (ARP56486_P050) antibody
Subunit:
2
Gene Symbol:
PSME2
Official Gene Full Name:
Proteasome (prosome, macropain) activator subunit 2 (PA28 beta)
Alias Symbols:
PA28B, PA28beta, REGbeta
NCBI Gene Id:
5721
Protein Name:
Proteasome activator complex subunit 2
Description of Target:
The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. The immunoproteasome contains an alternate regulator, referred to as the 11S regulator or PA28, that replaces the 19S regulator. Three subunits (alpha, beta and gamma) of the 11S regulator have been identified. This gene encodes the beta subunit of the 11S regulator, one of the two 11S subunits that is induced by gamma-interferon. Three beta and three alpha subunits combine to form a heterohexameric ring. Six pseudogenes have been identified on chromosomes 4, 5, 8, 10 and 13.
Swissprot Id:
Q9UL46
Protein Accession #:
NP_002809
Nucleotide Accession #:
NM_002818
Protein Size (# AA):
239
Molecular Weight:
27kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express PSME2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express PSME2.
Protein Interactions:
NAA10; PSMD14; SHFM1; UBC; PSME2; PSME1; PARK2; BAG3; NHLH1; MYOD1; EPHA2; CFTR; DDTL; TNN; CAP1; PTMA; PSMD7; PSMD2; PSMD1; PSMC5; PSMC4; PSMC2; PSMB5; PSMB3; PSMB1; PSMA6; PSMA5; PSMA3; PSMA2; PSMA1; GARS; APP; PSMC1; PSMD6; PSMB10; PSMB9; PSMB8; PSMB7;

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...