Psmd10 Antibody - N-terminal region (ARP56481_P050)

Catalog No: ARP56481_P050

Click here to learn more about Aviva's By-Request Conjugation Service.

WB Suggested Anti-Psmd10 Antibody
Titration: 1.0 ug/ml
Positive Control: Mouse Liver

Product Info

• Tested Species Reactivity: Mouse
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
• Peptide Sequence: Synthetic peptide located within the following region: KERILADKSLATRTDQDSRTALHWACSAGHTEIVEFLLQLGVPVNDKDDA
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-Psmd10 (ARP56481_P050) antibody is Catalog # AAP56481 (Previous Catalog # AAPP38936)
• Subunit: 10

Target Info

• Gene Symbol: Psmd10
• Gene Full Name: Proteasome (prosome, macropain) 26S subunit, non-ATPase, 10
• Alias Symbols: gan, AW554874
• NCBI Gene Id: 53380
• Protein Name: 26S proteasome non-ATPase regulatory subunit 10
• Description of Target: Psmd10 acts as a chaperone during the assembly of the 26S proteasome, specifically of the PA700/19S regulatory complex (RC). In the initial step of the base subcomplex assembly,Psmd10 is part of an intermediate PSMD10:PSMC4:PSMC5:PAAF1 module which probably assembles with a PSMD5:PSMC2:PSMC1:PSMD2 module By similarity.Psmd10 acts as an oncoprotein by being involved in negative regulation of tumor suppressors RB1 and p53/TP53. Overexpression of this gene is leading to phosphorylation of RB1 and proteasomal degradation of RB1. Psmd10 regulates CDK4-mediated phosphorylation of RB1 by competing with CDKN2A for binding with CDK4.
• Uniprot ID: Q9Z2X2
• Protein Accession #: NP_058579
• Nucleotide Accession #: NM_016883
• Protein Size (# AA): 231
• Molecular Weight: 25kDa
• Protein Interactions: Psmc4; Rb1; Cebpa; Cdk4;