Aviva Systems Biology will be closed in observance of Good Friday 3/29/2024. If you are in need of any assistance please email info@avivasysbio.com

Catalog No: ARP38192_T100
Price: $0.00
SKU
ARP38192_T100
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-PSMC5 (ARP38192_T100) antibody
Product Info
Tested Species ReactivityHuman, Mouse
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Guinea Pig, Horse, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, IP, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human PSMC5
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Peptide SequenceSynthetic peptide located within the following region: AEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEKNMSIKKLWK
Concentration1.0 mg/ml
Blocking PeptideFor anti-PSMC5 (ARP38192_T100) antibody is Catalog # AAP38192 (Previous Catalog # AAPP20368)
Subunit8
Other Applications Image 1 DataIP Suggested Anti-PSMC5 antibody
Titration: 2 ug/ml
Positive Control: Mouse brain homogenate
ReferenceInoue,T., et al., (2006) Biochem. Biophys. Res. Commun. 342 (3), 829-834
Publications

Effects of aging and reproduction on protein quality control in soma and gametes of Drosophila melanogaster. Aging Cell. 11, 634-43 (2012). 22507075

Description
Gene SymbolPSMC5
Gene Full NameProteasome (prosome, macropain) 26S subunit, ATPase, 5
Alias SymbolsS8, p45, RPT6, SUG1, SUG-1, TBP10, TRIP1, p45/SUG
NCBI Gene Id5705
Protein Name26S protease regulatory subunit 8
Description of TargetThe 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits.PSMC5 is one of the ATPase subunits, a member of the triple-A family of ATPases which have a chaperone-like activity. In addition to participation in proteasome functions, this subunit may participate in transcriptional regulation since it has been shown to interact with the thyroid hormone receptor and retinoid X receptor-alpha.
Uniprot IDP62195
Protein Accession #NP_002796
Nucleotide Accession #NM_002805
Protein Size (# AA)406
Molecular Weight46kDa
Protein InteractionsHUWE1; KRT38; KRT40; PDCL; CIITA; FOS; THAP11; SUMO2; SUMO3; Gabbr2; PSMD14; UBE3C; UBC; PSMB4; RPS13; RPL29; PSMD12; PSMD11; PSMD8; PSMD3; PSMD1; PSMC6; DYNC1I2; ABCF1; KCMF1; UCHL5; KIAA0368; UBR4; ADRM1; MAP2; PARK2; FBXO6; RORA; PSMC4; BAG3; HIV2gp7;
  1. What is the species homology for "PSMC5 Antibody - C-terminal region (ARP38192_T100)"?

    The tested species reactivity for this item is "Human, Mouse". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Guinea Pig, Horse, Rabbit, Zebrafish".

  2. How long will it take to receive "PSMC5 Antibody - C-terminal region (ARP38192_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "PSMC5 Antibody - C-terminal region (ARP38192_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "PSMC5 Antibody - C-terminal region (ARP38192_T100)"?

    This target may also be called "S8, p45, RPT6, SUG1, SUG-1, TBP10, TRIP1, p45/SUG" in publications.

  5. What is the shipping cost for "PSMC5 Antibody - C-terminal region (ARP38192_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "PSMC5 Antibody - C-terminal region (ARP38192_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "PSMC5 Antibody - C-terminal region (ARP38192_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "46kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "PSMC5 Antibody - C-terminal region (ARP38192_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "PSMC5"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "PSMC5"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "PSMC5"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "PSMC5"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "PSMC5"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "PSMC5"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:PSMC5 Antibody - C-terminal region (ARP38192_T100)
Your Rating
We found other products you might like!