Catalog No: ARP56716_P050
Price: $0.00
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-PSMC4 (ARP56716_P050) antibody
Product Info
ReferenceMarx,F.P., (2007) FASEB J. 21 (8), 1759-1767
Tested Species ReactivityHuman, Mouse
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ApplicationWB, IP
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human PSMC4
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 90%; Zebrafish: 93%
Peptide SequenceSynthetic peptide located within the following region: MEEIGILVEKAQDEIPALSVSRPQTGLSFLGPEPEDLEDLYSRYKKLQQE
Concentration0.5 mg/ml
Blocking PeptideFor anti-PSMC4 (ARP56716_P050) antibody is Catalog # AAP56716 (Previous Catalog # AAPP39525)
Gene SymbolPSMC4
Gene Full NameProteasome (prosome, macropain) 26S subunit, ATPase, 4
Alias SymbolsS6, RPT3, TBP7, TBP-7, MIP224
NCBI Gene Id5704
Protein Name26S protease regulatory subunit 6B
Description of TargetThe 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits a
Uniprot IDP43686
Protein Accession #NP_006494
Nucleotide Accession #NM_006503
Protein Size (# AA)418
Molecular Weight47kDa
  1. What is the species homology for "PSMC4 Antibody - N-terminal region (ARP56716_P050)"?

    The tested species reactivity for this item is "Human, Mouse". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish".

  2. How long will it take to receive "PSMC4 Antibody - N-terminal region (ARP56716_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "PSMC4 Antibody - N-terminal region (ARP56716_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact

  4. What are other names for "PSMC4 Antibody - N-terminal region (ARP56716_P050)"?

    This target may also be called "S6, RPT3, TBP7, TBP-7, MIP224" in publications.

  5. What is the shipping cost for "PSMC4 Antibody - N-terminal region (ARP56716_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "PSMC4 Antibody - N-terminal region (ARP56716_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "PSMC4 Antibody - N-terminal region (ARP56716_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "47kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "PSMC4 Antibody - N-terminal region (ARP56716_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "PSMC4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "PSMC4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "PSMC4"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "PSMC4"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "PSMC4"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "PSMC4"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:PSMC4 Antibody - N-terminal region (ARP56716_P050)
Your Rating
We found other products you might like!