Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP47615_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP47615_P050-FITC Conjugated

ARP47615_P050-HRP Conjugated

ARP47615_P050-Biotin Conjugated

PSMC3IP Antibody - C-terminal region (ARP47615_P050)

Catalog#: ARP47615_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityCow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-162289 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human PSMC3IP
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Goat: 93%; Guinea Pig: 79%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 100%; Rat: 100%; Zebrafish: 85%
Complete computational species homology dataAnti-PSMC3IP (ARP47615_P050)
Peptide SequenceSynthetic peptide located within the following region: PEEKEQVYRERQKYCKEWRKRKRMATELSDAILEGYPKSKKQFFEEVGIE
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-PSMC3IP (ARP47615_P050) antibody is Catalog # AAP47615 (Previous Catalog # AAPP28473)
Datasheets/ManualsPrintable datasheet for anti-PSMC3IP (ARP47615_P050) antibody
Sample Type Confirmation

PSMC3IP is strongly supported by BioGPS gene expression data to be expressed in 721_B

Target ReferenceEnomoto,R., (2006) J. Biol. Chem. 281 (9), 5575-5581
Gene SymbolPSMC3IP
Official Gene Full NamePSMC3 interacting protein
Alias SymbolsGT198, HOP2, TBPIP, ODG3, HUMGT198A
NCBI Gene Id29893
Protein NameHomologous-pairing protein 2 homolog
Description of TargetPSMC3IP plays an important role in meiotic recombination. It stimulates DMC1-mediated strand exchange required for pairing homologous chromosomes during meiosis. The complex PSMC3IP/MND1 binds DNA, stimulates the recombinase activity of DMC1 as well as DMC1 D-loop formation from double-strand DNA. This complex stabilizes presynaptic RAD51 and DMC1 filaments formed on single strand DNA to capture double-strand DNA. This complex stimulates both synaptic and presynaptic critical steps in RAD51 and DMC1-promoted homologous pairing. It may inhibit HIV-1 viral protein TAT activity and modulate the activity of proteasomes through association with PSMC3.
Swissprot IdQ9P2W1
Protein Accession #NP_037422
Nucleotide Accession #NM_013290
Protein Size (# AA)205
Molecular Weight24kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express PSMC3IP.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express PSMC3IP.
Protein InteractionsPSMC3; PSMC3IP; THRB; ESR2; AR; RXRA; NR3C1;
Write Your Own Review
You're reviewing:PSMC3IP Antibody - C-terminal region (ARP47615_P050)
Your Rating
Free Microscope
Aviva Validation Data
Aviva ChIP Antibodies
Assay Development