Search Antibody, Protein, and ELISA Kit Solutions

PSMC3IP Antibody - C-terminal region (ARP47615_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP47615_P050-FITC Conjugated

ARP47615_P050-HRP Conjugated

ARP47615_P050-Biotin Conjugated

Gene Symbol:
PSMC3IP
Official Gene Full Name:
PSMC3 interacting protein
NCBI Gene Id:
29893
Protein Name:
Homologous-pairing protein 2 homolog
Swissprot Id:
Q9P2W1
Protein Accession #:
NP_037422
Nucleotide Accession #:
NM_013290
Alias Symbols:
GT198, HOP2, TBPIP, ODG3, HUMGT198A
Replacement Item:
This antibody may replace item sc-162289 from Santa Cruz Biotechnology.
Description of Target:
PSMC3IP plays an important role in meiotic recombination. It stimulates DMC1-mediated strand exchange required for pairing homologous chromosomes during meiosis. The complex PSMC3IP/MND1 binds DNA, stimulates the recombinase activity of DMC1 as well as DMC1 D-loop formation from double-strand DNA. This complex stabilizes presynaptic RAD51 and DMC1 filaments formed on single strand DNA to capture double-strand DNA. This complex stimulates both synaptic and presynaptic critical steps in RAD51 and DMC1-promoted homologous pairing. It may inhibit HIV-1 viral protein TAT activity and modulate the activity of proteasomes through association with PSMC3.
Protein Size (# AA):
205
Molecular Weight:
24kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express PSMC3IP.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express PSMC3IP.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human PSMC3IP
Predicted Species Reactivity:
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Goat: 93%; Guinea Pig: 79%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 100%; Rat: 100%; Zebrafish: 85%
Complete computational species homology data:
Anti-PSMC3IP (ARP47615_P050)
Peptide Sequence:
Synthetic peptide located within the following region: PEEKEQVYRERQKYCKEWRKRKRMATELSDAILEGYPKSKKQFFEEVGIE
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
PSMC3; PSMC3IP; THRB; ESR2; AR; RXRA; NR3C1;
Blocking Peptide:
For anti-PSMC3IP (ARP47615_P050) antibody is Catalog # AAP47615 (Previous Catalog # AAPP28473)
Datasheets/Manuals:
Printable datasheet for anti-PSMC3IP (ARP47615_P050) antibody
Sample Type Confirmation:

PSMC3IP is strongly supported by BioGPS gene expression data to be expressed in 721_B

Target Reference:
Enomoto,R., (2006) J. Biol. Chem. 281 (9), 5575-5581

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...