SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP46081_P050-HRP
Size:100ul
Price: $434.00
SKU
ARP46081_P050-HRP
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

PSMB9 Antibody - C-terminal region : HRP (ARP46081_P050-HRP)

Datasheets/ManualsPrintable datasheet for anti-PSMB9 (ARP46081_P050-HRP) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
ClonalityPolyclonal
HostRabbit
ConjugationHRP: Horseradish Peroxidase
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human PSMB9
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 92%; Dog: 92%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Peptide SequenceSynthetic peptide located within the following region: RRFTTDAIALAMSRDGSSGGVIYLVTITAAGVDHRVILGNELPKFYDE
Concentration0.5 mg/ml
Blocking PeptideFor anti-PSMB9 (ARP46081_P050-HRP) antibody is Catalog # AAP46081 (Previous Catalog # AAPP26943)
Sample Type Confirmation

PSMB9 is supported by BioGPS gene expression data to be expressed in Jurkat

Subunitbeta type-9
ReferenceDeshpande,A., (2008) J. Infect. Dis. 197 (3), 371-381
Gene SymbolPSMB9
Gene Full NameProteasome (prosome, macropain) subunit, beta type, 9 (large multifunctional peptidase 2)
Alias SymbolsLMP2, PRAAS3, PSMB6i, RING12, beta1i
NCBI Gene Id5698
Protein NameProteasome subunit beta type-9
Description of TargetThe proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. PSMB9 is a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit. This subunit is involved in antigen processing to generate class I binding peptides. Expression of PSMB9 is induced by gamma interferon and it replaces catalytic subunit 1 (proteasome beta 6 subunit) in the immunoproteasome. The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit. This gene is located in the class II region of the MHC (major histocompatibility complex). Expression of this gene is induced by gamma interferon and this gene product replaces catalytic subunit 1 (proteasome beta 6 subunit) in the immunoproteasome. Proteolytic processing is required to generate a mature subunit. Two alternative transcripts encoding different isoforms have been identified; both isoforms are processed to yield the same mature subunit.
Uniprot IDP28065
Protein Accession #NP_002791
Nucleotide Accession #NM_002800
Protein Size (# AA)219
Molecular Weight21kDa
Protein InteractionsNCOA3; TCEB3; SRC; POLR2L; POLR2K; POLR2J; POLR2I; POLR2H; POLR2G; POLR2F; POLR2E; POLR2D; POLR2C; POLR2B; ESR1; NCOA2; UBC; HCVgp1; PSMA2; PSMB5; PSME2; PSME1; PSMB6; PSMA3; POMP; PSMB8; PSMB7; PSMA7; PSMA1; PSMB9; PSMC5; PSMA4; POLR2A; NCOA1; PSMB10;
  1. What is the species homology for "PSMB9 Antibody - C-terminal region : HRP (ARP46081_P050-HRP)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish".

  2. How long will it take to receive "PSMB9 Antibody - C-terminal region : HRP (ARP46081_P050-HRP)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "PSMB9 Antibody - C-terminal region : HRP (ARP46081_P050-HRP)" provided in?

    This item is provided in "Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "PSMB9 Antibody - C-terminal region : HRP (ARP46081_P050-HRP)"?

    This target may also be called "LMP2, PRAAS3, PSMB6i, RING12, beta1i" in publications.

  5. What is the shipping cost for "PSMB9 Antibody - C-terminal region : HRP (ARP46081_P050-HRP)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "PSMB9 Antibody - C-terminal region : HRP (ARP46081_P050-HRP)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "PSMB9 Antibody - C-terminal region : HRP (ARP46081_P050-HRP)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "21kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "PSMB9 Antibody - C-terminal region : HRP (ARP46081_P050-HRP)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "PSMB9"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "PSMB9"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "PSMB9"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "PSMB9"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "PSMB9"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "PSMB9"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:PSMB9 Antibody - C-terminal region : HRP (ARP46081_P050-HRP)
Your Rating
We found other products you might like!