Search Antibody, Protein, and ELISA Kit Solutions

PSMB9 Antibody - C-terminal region (ARP46081_P050)

100 ul

Regular Price: $319.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP46081_P050-FITC Conjugated

ARP46081_P050-HRP Conjugated

ARP46081_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-16459 from Santa Cruz Biotechnology.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human PSMB9
Purification:
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 92%; Dog: 92%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Complete computational species homology data:
Anti-PSMB9 (ARP46081_P050)
Peptide Sequence:
Synthetic peptide located within the following region: RRFTTDAIALAMSRDGSSGGVIYLVTITAAGVDHRVILGNELPKFYDE
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-PSMB9 (ARP46081_P050) antibody is Catalog # AAP46081 (Previous Catalog # AAPP26943)
Datasheets/Manuals:
Printable datasheet for anti-PSMB9 (ARP46081_P050) antibody
Sample Type Confirmation:

PSMB9 is supported by BioGPS gene expression data to be expressed in Jurkat

Subunit:
beta type-9
Target Reference:
Deshpande,A., (2008) J. Infect. Dis. 197 (3), 371-381
Gene Symbol:
PSMB9
Official Gene Full Name:
Proteasome (prosome, macropain) subunit, beta type, 9 (large multifunctional peptidase 2)
Alias Symbols:
LMP2, MGC70470, RING12, PSMB6i, beta1i
NCBI Gene Id:
5698
Protein Name:
Proteasome subunit beta type-9
Description of Target:
The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. PSMB9 is a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit. This subunit is involved in antigen processing to generate class I binding peptides. Expression of PSMB9 is induced by gamma interferon and it replaces catalytic subunit 1 (proteasome beta 6 subunit) in the immunoproteasome. The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit. This gene is located in the class II region of the MHC (major histocompatibility complex). Expression of this gene is induced by gamma interferon and this gene product replaces catalytic subunit 1 (proteasome beta 6 subunit) in the immunoproteasome. Proteolytic processing is required to generate a mature subunit. Two alternative transcripts encoding different isoforms have been identified; both isoforms are processed to yield the same mature subunit.
Swissprot Id:
P28065
Protein Accession #:
NP_002791
Nucleotide Accession #:
NM_002800
Protein Size (# AA):
219
Molecular Weight:
21kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express PSMB9.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express PSMB9.
Protein Interactions:
NCOA3; TCEB3; SRC; POLR2L; POLR2K; POLR2J; POLR2I; POLR2H; POLR2G; POLR2F; POLR2E; POLR2D; POLR2C; POLR2B; ESR1; NCOA2; UBC; HCVgp1; PSMA2; PSMB5; PSME2; PSME1; PSMB6; PSMA3; POMP; PSMB8; PSMB7; PSMA7; PSMA1; PSMB9; PSMC5; PSMA4; POLR2A; NCOA1; PSMB10;

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...