PSMB10 Recombinant Protein (Human) (OPCA04861)

Catalog No: OPCA04861

Product Info

• Predicted Species Reactivity: Homo sapiens|Human
• Product Format: Liquid or Lyophilized powder
• Additional Information: Species Specificity Detail: Homo sapiens (Human)
• Reconstitution and Storage: -20°C or -80°C
• Formulation: Tris-base, 50% glycerol
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: MLKPALEPRGGFSFENCQRNASLERVLPGLKVPHARKTGTTIAGLVFQDGVILGADTRATNDSVVADKSCEKIHFIAPKIYCCGAGVAADAEMTTRMVASKMELHALSTGREPRVATVTRILRQTLFRYQGHVGASLIVGGVDLTGPQLYGVHPHGSYSRLPFTALGSGQDAALAVLEDRFQPNMTLEAAQGLLVEAVTAGILGDLGSGGNVDACVITKTGAKLLRTLSSPTEPVKRSGRYHFVPGTTAVLTQTVKPLTLELVEETVQAMEVE
• Protein Sequence: MLKPALEPRGGFSFENCQRNASLERVLPGLKVPHARKTGTTIAGLVFQDGVILGADTRATNDSVVADKSCEKIHFIAPKIYCCGAGVAADAEMTTRMVASKMELHALSTGREPRVATVTRILRQTLFRYQGHVGASLIVGGVDLTGPQLYGVHPHGSYSRLPFTALGSGQDAALAVLEDRFQPNMTLEAAQGLLVEAVTAGILGDLGSGGNVDACVITKTGAKLLRTLSSPTEPVKRSGRYHFVPGTTAVLTQTVKPLTLELVEETVQAMEVE
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: E.coli
• Protein Range: 1-273 aa
• Tag: N-terminal GST-tagged
• Reference: A tight cluster of five unrelated human genes on chromosome 16q22.1. Larsen F., Solheim J., Kristensen T., Kolstoe A.-B., Prydz H. Hum. Mol. Genet. 2:1589-1595(1993)

Target Info

• Gene Symbol: PSMB10
• Gene Full Name: proteasome 20S subunit beta 10
• Alias Symbols: beta2i;LMP10;low molecular mass protein 10;macropain subunit MECl-1;MECL1;multicatalytic endopeptidase complex subunit MECl-1;PRAAS5;proteasome (prosome, macropain) subunit, beta type, 10;proteasome catalytic subunit 2i;proteasome MECl-1;proteasome subunit beta 10;proteasome subunit beta 7i;proteasome subunit beta type-10;proteasome subunit beta2i;proteasome subunit beta-2i;proteasome subunit MECL1.
• NCBI Gene Id: 5699
• Protein Name: Proteasome subunit beta type-10
• Description of Target: The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. This subunit is involved in antigen processing to generate class I binding peptides.
• Uniprot ID: P40306
• Protein Accession #: NP_002792
• Nucleotide Accession #: NM_002801
• Protein Size (# AA): Recombinant
• Molecular Weight: 51.6 kDa