Loading...
Catalog No: ARP57743_P050
Price: $0.00
SKU
ARP57743_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-PSMA3 (ARP57743_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human PSMA3
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 90%; Zebrafish: 79%
Peptide SequenceSynthetic peptide located within the following region: VKDKAFELELSWVGELTNGRHEIVPKDIREEAEKYAKESLKEEDESDDDN
Concentration0.5 mg/ml
Blocking PeptideFor anti-PSMA3 (ARP57743_P050) antibody is Catalog # AAP57743 (Previous Catalog # AAPP35446)
Sample Type Confirmation

PSMA3 is supported by BioGPS gene expression data to be expressed in 721_B, HeLa

Subunitalpha type-3
ReferenceOlsen,J.V., (2006) Cell 127 (3), 635-648
Gene SymbolPSMA3
Gene Full NameProteasome (prosome, macropain) subunit, alpha type, 3
Alias SymbolsHC8, PSC3
NCBI Gene Id5684
Protein NameProteasome subunit alpha type-3
Description of TargetThe proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. PSMA3 is a member of the peptidase T1A family, that is a 20S core alpha subunit.The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the peptidase T1A family, that is a 20S core alpha subunit. Two alternative transcripts encoding different isoforms have been identified.
Uniprot IDP25788-2
Protein Accession #NP_687033
Nucleotide Accession #NM_152132
Protein Size (# AA)248
Molecular Weight28kDa
Protein InteractionsSF1; STX4; SNRPC; SNRPB; RAB3IL1; PSMB4; PSMA6; PSMA3; PSMA1; NPPB; CTAGE5; LETM1; LASP1; KRAS; NPBWR2; GATA3; GATA2; CYBA; CST2; CDK6; ATP6V0C; DMC1; SLMO1; BTN2A2; STX6; SERF2; HUWE1; APLN; C1QTNF9B-AS1; C9orf106; KRTAP26-1; KRTAP19-5; KRTAP8-1; RTP5; R
  1. What is the species homology for "PSMA3 Antibody - middle region (ARP57743_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish".

  2. How long will it take to receive "PSMA3 Antibody - middle region (ARP57743_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "PSMA3 Antibody - middle region (ARP57743_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "PSMA3 Antibody - middle region (ARP57743_P050)"?

    This target may also be called "HC8, PSC3" in publications.

  5. What is the shipping cost for "PSMA3 Antibody - middle region (ARP57743_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "PSMA3 Antibody - middle region (ARP57743_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "PSMA3 Antibody - middle region (ARP57743_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "28kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "PSMA3 Antibody - middle region (ARP57743_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "PSMA3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "PSMA3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "PSMA3"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "PSMA3"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "PSMA3"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "PSMA3"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:PSMA3 Antibody - middle region (ARP57743_P050)
Your Rating
We found other products you might like!