Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP40417_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP40417_P050-FITC Conjugated

ARP40417_P050-HRP Conjugated

ARP40417_P050-Biotin Conjugated

PSMA1 Antibody - C-terminal region (ARP40417_P050)

Catalog#: ARP40417_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-112756 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human PSMA1
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data Anti-PSMA1 (ARP40417_P050)
Peptide Sequence Synthetic peptide located within the following region: TYLERHMSEFMECNLNELVKHGLRALRETLPAEQDLTTKNVSIGIVGKDL
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-PSMA1 (ARP40417_P050) antibody is Catalog # AAP40417 (Previous Catalog # AAPP23493)
Datasheets/Manuals Printable datasheet for anti-PSMA1 (ARP40417_P050) antibody
Sample Type Confirmation

PSMA1 is strongly supported by BioGPS gene expression data to be expressed in NCI460

Subunit alpha type-1
Target Reference Conticello,S.G., (2003) Curr. Biol. 13 (22), 2009-2013
Publications

Cron, K. R. et al. Proteasome inhibitors block DNA repair and radiosensitize non-small cell lung cancer. PLoS One 8, e73710 (2013). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 24040035

Gene Symbol PSMA1
Official Gene Full Name Proteasome (prosome, macropain) subunit, alpha type, 1
Alias Symbols HC2, MGC14542, MGC14575, MGC14751, MGC1667, MGC21459, MGC22853, MGC23915, NU, PROS30
NCBI Gene Id 5682
Protein Name Proteasome subunit alpha type-1
Description of Target The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. PSMA1 is a member of the peptidase T1A family which is a 20S core alpha subunit.The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the peptidase T1A family, that is a 20S core alpha subunit. Two alternative transcripts encoding different isoforms have been identified.The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the peptidase T1A family, that is a 20S core alpha subunit. Two alternative transcripts encoding different isoforms have been identified.
Swissprot Id P25786
Protein Accession # NP_002777
Nucleotide Accession # NM_002786
Protein Size (# AA) 263
Molecular Weight 29kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express PSMA1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express PSMA1.
Protein Interactions PRDM14; CEP70; CCDC102B; GNPTAB; CEP72; KCTD9; ROPN1; ABI3; SH3GLB1; APIP; LDOC1; MTUS2; MAPRE3; MAPRE1; IKZF3; MID2; EHMT2; PNMA2; IKZF1; TRIM10; HUWE1; HOMER3; PNMA1; KRT38; BLZF1; MAD1L1; MKRN3; REL; PSMA3; MLH1; KRT31; KRT15; KRTAP5-9; GOLGA2; CDA; CC
  1. What is the species homology for "PSMA1 Antibody - C-terminal region (ARP40417_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish".

  2. How long will it take to receive "PSMA1 Antibody - C-terminal region (ARP40417_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "PSMA1 Antibody - C-terminal region (ARP40417_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "PSMA1 Antibody - C-terminal region (ARP40417_P050)"?

    This target may also be called "HC2, MGC14542, MGC14575, MGC14751, MGC1667, MGC21459, MGC22853, MGC23915, NU, PROS30" in publications.

  5. What is the shipping cost for "PSMA1 Antibody - C-terminal region (ARP40417_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "PSMA1 Antibody - C-terminal region (ARP40417_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "PSMA1 Antibody - C-terminal region (ARP40417_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "29kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "PSMA1 Antibody - C-terminal region (ARP40417_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "PSMA1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "PSMA1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "PSMA1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "PSMA1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "PSMA1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "PSMA1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:PSMA1 Antibody - C-terminal region (ARP40417_P050)
Your Rating
We found other products you might like!