Aviva Systems Biology office will be closed for Good Friday - April 19, 2019.
Please go here for more info.

Search Antibody, Protein, and ELISA Kit Solutions

PSMA1 Antibody - C-terminal region (ARP40417_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP40417_P050-FITC Conjugated

ARP40417_P050-HRP Conjugated

ARP40417_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
Proteasome (prosome, macropain) subunit, alpha type, 1
NCBI Gene Id:
Protein Name:
Proteasome subunit alpha type-1
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
HC2, MGC14542, MGC14575, MGC14751, MGC1667, MGC21459, MGC22853, MGC23915, NU, PROS30
Replacement Item:
This antibody may replace item sc-112756 from Santa Cruz Biotechnology.
Description of Target:
The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. PSMA1 is a member of the peptidase T1A family which is a 20S core alpha subunit.The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the peptidase T1A family, that is a 20S core alpha subunit. Two alternative transcripts encoding different isoforms have been identified.The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the peptidase T1A family, that is a 20S core alpha subunit. Two alternative transcripts encoding different isoforms have been identified.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express PSMA1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express PSMA1.
The immunogen is a synthetic peptide directed towards the C terminal region of human PSMA1
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data:
Anti-PSMA1 (ARP40417_P050)
Peptide Sequence:
Synthetic peptide located within the following region: TYLERHMSEFMECNLNELVKHGLRALRETLPAEQDLTTKNVSIGIVGKDL
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-PSMA1 (ARP40417_P050) antibody is Catalog # AAP40417 (Previous Catalog # AAPP23493)
Printable datasheet for anti-PSMA1 (ARP40417_P050) antibody
Sample Type Confirmation:

PSMA1 is strongly supported by BioGPS gene expression data to be expressed in NCI460

alpha type-1
Target Reference:
Conticello,S.G., (2003) Curr. Biol. 13 (22), 2009-2013

Cron, K. R. et al. Proteasome inhibitors block DNA repair and radiosensitize non-small cell lung cancer. PLoS One 8, e73710 (2013). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 24040035

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...