Search Antibody, Protein, and ELISA Kit Solutions

PSEN2 Antibody - N-terminal region (ARP44289_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP44289_P050-FITC Conjugated

ARP44289_P050-HRP Conjugated

ARP44289_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
Presenilin 2 (Alzheimer disease 4)
NCBI Gene Id:
Protein Name:
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-1456 from Santa Cruz Biotechnology.
Description of Target:
Alzheimer's disease (AD) patients with an inherited form of the disease carry mutations in the presenilin proteins (PSEN1 or PSEN2) or the amyloid precursor protein (APP). These disease-linked mutations result in increased production of the longer form of amyloid-beta (main component of amyloid deposits found in AD brains). Presenilins are postulated to regulate APP processing through their effects on gamma-secretase, an enzyme that cleaves APP. Also, it is thought that the presenilins are involved in the cleavage of the Notch receptor such that, they either directly regulate gamma-secretase activity, or themselves act are protease enzymes.Alzheimer's disease (AD) patients with an inherited form of the disease carry mutations in the presenilin proteins (PSEN1; PSEN2) or the amyloid precursor protein (APP). These disease-linked mutations result in increased production of the longer form of amyloid-beta (main component of amyloid deposits found in AD brains). Presenilins are postulated to regulate APP processing through their effects on gamma-secretase, an enzyme that cleaves APP. Also, it is thought that the presenilins are involved in the cleavage of the Notch receptor, such that that they either directly regulate gamma-secretase activity or themselves are protease enzymes. Two alternative transcripts of PSEN2 have been identified.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express PSEN2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express PSEN2.
The immunogen is a synthetic peptide directed towards the N terminal region of human PSEN2
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Tested Species Reactivity:
Human, Mouse
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 85%
Complete computational species homology data:
Anti-PSEN2 (ARP44289_P050)
Peptide Sequence:
Synthetic peptide located within the following region: VVVATIKSVRFYTEKNGQLIYTPFTEDTPSVGQRLLNSVLNTLIMISVIV
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-PSEN2 (ARP44289_P050) antibody is Catalog # AAP44289 (Previous Catalog # AAPP25668)
Printable datasheet for anti-PSEN2 (ARP44289_P050) antibody
Target Reference:
da (2005) Curr Alzheimer Res 2 (5), 507-514

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...