Search Antibody, Protein, and ELISA Kit Solutions

PSEN2 Antibody - middle region (ARP97209_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Tested Species Reactivity:
Mouse
Predicted Species Reactivity:
Mouse
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
PSEN2
Official Gene Full Name:
PS2, Ad4h, Alg3, PS-2, STM2, ALG-3, Psnl2
NCBI Gene Id:
19165
Protein Name:
presenilin-2
Swissprot Id:
Q61144
Protein Accession #:
NP_001122077.1
Nucleotide Accession #:
NM_001128605.1
Alias Symbols:
presenilin-2
Description of Target:
This gene encodes a member of the presenilin family. Presenilins are catalytic components of the multi-subunit gamma-secretase complex, which mediates critical cellular processes through cleavage of type I transmembrane proteins including Notch receptors and the amyloid precursor protein. The encoded protein contains eight transmembrane domains and is localized to the endoplasmic reticulum, where it may play a role in calcium homeostasis. Following assembly of the gamma-secretase complex, the encoded protein is cleaved into N- and C-terminal fragments and the activated complex is released from the endoplasmic reticulum. Inactivation of this gene results in impaired synaptic function in a mouse model for Alzheimer's disease. Alternatively spliced transcript variants have been observed for this gene. 
Protein Size (# AA):
448
Molecular Weight:
50 kDa
Purification:
Affinity purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express COQ3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express PSEN2.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of mouse PSEN2
Peptide Sequence:
Synthetic peptide located within the following region: ALVFIKYLPEWSAWVILGAISVYDLVAVLCPKGPLRMLVETAQERNEPIF
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-PSEN2 (ARP97209_P050) antibody is Catalog # AAP97209
Datasheets/Manuals:
Printable datasheet for anti-PSEN2 (ARP97209_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...