PSEN2 Antibody - middle region (ARP97209_P050)

Catalog No: ARP97209_P050

Host: Rabbit
Target Name: PSEN2
Sample Tissue: Mouse Pancreas lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Mouse
• Predicted Species Reactivity: Mouse
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of mouse PSEN2
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: ALVFIKYLPEWSAWVILGAISVYDLVAVLCPKGPLRMLVETAQERNEPIF
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-PSEN2 (ARP97209_P050) antibody is Catalog # AAP97209

Target Info

• Gene Symbol: PSEN2
• Gene Full Name: PS2, Ad4h, Alg3, PS-2, STM2, ALG-3, Psnl2
• Alias Symbols: P, PS, ALG, Ad4, PS2, Ad4h, Alg3, PS-2, STM2, ALG-3, Psnl2
• NCBI Gene Id: 19165
• Protein Name: presenilin-2
• Description of Target: This gene encodes a member of the presenilin family. Presenilins are catalytic components of the multi-subunit gamma-secretase complex, which mediates critical cellular processes through cleavage of type I transmembrane proteins including Notch receptors and the amyloid precursor protein. The encoded protein contains eight transmembrane domains and is localized to the endoplasmic reticulum, where it may play a role in calcium homeostasis. Following assembly of the gamma-secretase complex, the encoded protein is cleaved into N- and C-terminal fragments and the activated complex is released from the endoplasmic reticulum. Inactivation of this gene results in impaired synaptic function in a mouse model for Alzheimer's disease. Alternatively spliced transcript variants have been observed for this gene. 
• Uniprot ID: Q61144
• Protein Accession #: NP_001122077.1
• Nucleotide Accession #: NM_001128605.1
• Protein Size (# AA): 448
• Molecular Weight: 50 kDa