Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP97209_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

PSEN2 Antibody - middle region (ARP97209_P050)

Catalog#: ARP97209_P050
Domestic: within 24 hours delivery | International: 3-34 business days
More Information
Tested Species Reactivity Mouse
Predicted Species Reactivity Mouse
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of mouse PSEN2
Purification Affinity purified
Peptide Sequence Synthetic peptide located within the following region: ALVFIKYLPEWSAWVILGAISVYDLVAVLCPKGPLRMLVETAQERNEPIF
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-PSEN2 (ARP97209_P050) antibody is Catalog # AAP97209
Datasheets/Manuals Printable datasheet for anti-PSEN2 (ARP97209_P050) antibody
Gene Symbol PSEN2
Official Gene Full Name PS2, Ad4h, Alg3, PS-2, STM2, ALG-3, Psnl2
Alias Symbols presenilin-2
NCBI Gene Id 19165
Protein Name presenilin-2
Description of Target This gene encodes a member of the presenilin family. Presenilins are catalytic components of the multi-subunit gamma-secretase complex, which mediates critical cellular processes through cleavage of type I transmembrane proteins including Notch receptors and the amyloid precursor protein. The encoded protein contains eight transmembrane domains and is localized to the endoplasmic reticulum, where it may play a role in calcium homeostasis. Following assembly of the gamma-secretase complex, the encoded protein is cleaved into N- and C-terminal fragments and the activated complex is released from the endoplasmic reticulum. Inactivation of this gene results in impaired synaptic function in a mouse model for Alzheimer's disease. Alternatively spliced transcript variants have been observed for this gene. 
Swissprot Id Q61144
Protein Accession # NP_001122077.1
Nucleotide Accession # NM_001128605.1
Protein Size (# AA) 448
Molecular Weight 50 kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express COQ3.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express PSEN2.
  1. What is the species homology for "PSEN2 Antibody - middle region (ARP97209_P050)"?

    The tested species reactivity for this item is "Mouse". This antibody is predicted to have homology to "Mouse".

  2. How long will it take to receive "PSEN2 Antibody - middle region (ARP97209_P050)"?

    This item is available "Domestic: within 24 hours delivery | International: 3-34 business days".

  3. What buffer format is "PSEN2 Antibody - middle region (ARP97209_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "PSEN2 Antibody - middle region (ARP97209_P050)"?

    This target may also be called "presenilin-2" in publications.

  5. What is the shipping cost for "PSEN2 Antibody - middle region (ARP97209_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "PSEN2 Antibody - middle region (ARP97209_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "PSEN2 Antibody - middle region (ARP97209_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "50 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "PSEN2 Antibody - middle region (ARP97209_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "PSEN2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "PSEN2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "PSEN2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "PSEN2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "PSEN2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "PSEN2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:PSEN2 Antibody - middle region (ARP97209_P050)
Your Rating