Search Antibody, Protein, and ELISA Kit Solutions

PSEN2 Antibody - C-terminal region (ARP58940_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP58940_P050-FITC Conjugated

ARP58940_P050-HRP Conjugated

ARP58940_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
PSEN2
Official Gene Full Name:
presenilin 2
NCBI Gene Id:
5664
Protein Name:
presenilin-2
Swissprot Id:
E5RG63
Protein Accession #:
XP_011542538.1
Nucleotide Accession #:
XM_011544236.1
Alias Symbols:
AD4, PS2, AD3L, STM2, CMD1V
Replacement Item:
This antibody may replace item sc-1456 from Santa Cruz Biotechnology.
Description of Target:
Alzheimer's disease (AD) patients with an inherited form of the disease carry mutations in the presenilin proteins (PSEN1 or PSEN2) or the amyloid precursor protein (APP). These disease-linked mutations result in increased production of the longer form of amyloid-beta (main component of amyloid deposits found in AD brains). Presenilins are postulated to regulate APP processing through their effects on gamma-secretase, an enzyme that cleaves APP. Also, it is thought that the presenilins are involved in the cleavage of the Notch receptor such that, they either directly regulate gamma-secretase activity, or themselves act are protease enzymes. Two alternatively spliced transcript variants encoding different isoforms of PSEN2 have been identified.
Protein Size (# AA):
304
Molecular Weight:
33kDa
Purification:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express PSEN2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express PSEN2.
Immunogen:
The immunogen is a synthetic peptide directed towards the C-terminal region of human PSEN2
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 90%; Zebrafish: 100%
Complete computational species homology data:
Anti-PSEN2 (ARP58940_P050)
Peptide Sequence:
Synthetic peptide located within the following region: PYDPEMEEDSYDSFGEPSYPEVFEPPLTGYPGEELEEEEERGVKLGLGDF
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-PSEN2 (ARP58940_P050) antibody is Catalog # AAP58940
Datasheets/Manuals:
Printable datasheet for anti-PSEN2 (ARP58940_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...