PSCD4 Antibody - N-terminal region (ARP54947_P050)

Catalog No: ARP54947_P050

Click here to learn more about Aviva's By-Request Conjugation Service.

WB Suggested Anti-PSCD4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Liver

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PSCD4
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 93%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 93%; Rat: 93%; Zebrafish: 91%
• Peptide Sequence: Synthetic peptide located within the following region: NKTAIGTYLGERDPINLQVLQAFVDCHEFANLNLVQALRQFLWSFRLPGE
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-CYTH4 (ARP54947_P050) antibody is Catalog # AAP54947 (Previous Catalog # AAPP37205)

Target Info

• Reference: Morishige,M., (2008) Nat. Cell Biol. 10 (1), 85-92
• Gene Symbol: CYTH4
• Gene Full Name: Cytohesin 4
• Alias Symbols: CYT4, PSCD4, DJ63G5.1, cytohesin-4
• NCBI Gene Id: 27128
• Protein Name: Cytohesin-4
• Description of Target: PSCD4 promotes guanine-nucleotide exchange on ARF1 and ARF5. PSCD4 promotes the activation of ARF through replacement of GDP with GTP.Pleckstrin homology, Sec7 and coiled/coil domains 4 (PSCD4) is a member of the PSCD family. Members of this family have identical structural organization that consists of an N-terminal coiled-coil motif, a central Sec7 domain, and a C-terminal pleckstrin homology (PH) domain. The coiled-coil motif is involved in homodimerization, the Sec7 domain contains guanine-nucleotide exchange protein (GEP) activity, and the PH domain interacts with phospholipids and is responsible for association of PSCDs with membranes. Members of this family appear to mediate the regulation of protein sorting and membrane trafficking. The PSCD4 exhibits GEP activity in vitro with both ARF1 and ARF5 but is inactive with ARF6. The PSCD4 and PSCD1 gene structures are very similar.
• Uniprot ID: Q9UIA0
• Protein Accession #: NP_037517
• Nucleotide Accession #: NM_013385
• Protein Size (# AA): 394
• Molecular Weight: 46kDa
• Protein Interactions: KRT40; TRIM54; AMOTL2; SNAPC5; CNKSR1; KRT15; KIFC3; FOS; UBC; IPCEF1;