Search Antibody, Protein, and ELISA Kit Solutions

PRTN3 Antibody - N-terminal region (ARP61166_P050)

100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP61166_P050-FITC Conjugated

ARP61166_P050-HRP Conjugated

ARP61166_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Human
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-19746 from Santa Cruz Biotechnology.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human PRTN3
Purification:
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Human: 100%
Complete computational species homology data:
Anti-PRTN3 (ARP61166_P050)
Peptide Sequence:
Synthetic peptide located within the following region: IPQRLVNVVLGAHNVRTQEPTQQHFSVAQVFLNNYDAENKLNDVLLIQLS
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-PRTN3 (ARP61166_P050) antibody is Catalog # AAP61166 (Previous Catalog # AAPP47317)
Datasheets/Manuals:
Printable datasheet for anti-PRTN3 (ARP61166_P050) antibody
Gene Symbol:
PRTN3
Official Gene Full Name:
Proteinase 3
Alias Symbols:
ACPA, AGP7, C-ANCA, CANCA, MBN, MBT, NP4, P29, PR-3, PR3
NCBI Gene Id:
5657
Protein Name:
Myeloblastin
Description of Target:
PRTN3 is a polymorphonuclear leukocyte serine protease that degrades elastin, fibronectin, laminin, vitronectin, and collagen types I, III, and IV (in vitro) and causes emphysema when administered by tracheal insufflation to hamsters.
Swissprot Id:
P24158
Protein Accession #:
NP_002768
Nucleotide Accession #:
NM_002777
Protein Size (# AA):
256
Molecular Weight:
28kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express PRTN3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express PRTN3.
Protein Interactions:
Serpinb1a; SMAD3; IL32; SERPINB13; F2RL1; CAMP; ITGB2; SERPINA1; TNF; F2R; RELA; IL1B; ELN; SERPINB1; ITGAM;

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...