Search Antibody, Protein, and ELISA Kit Solutions

PRSS16 Antibody - N-terminal region (ARP42265_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP42265_P050-FITC Conjugated

ARP42265_P050-HRP Conjugated

ARP42265_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
PRSS16
Official Gene Full Name:
serine protease 16
NCBI Gene Id:
10279
Protein Name:
thymus-specific serine protease
Swissprot Id:
Q9NQE7
Protein Accession #:
NP_005856
Alias Symbols:
TSSP
Description of Target:
This gene encodes a serine protease expressed exclusively in the thymus. It is thought to play a role in the alternative antigen presenting pathway used by cortical thymic epithelial cells during the positive selection of T cells. The gene is found in the large histone gene cluster on chromosome 6, near the major histocompatibility complex (MHC) class I region. A second transcript variant has been described, but its full length nature has not been determined.
Protein Size (# AA):
514
Molecular Weight:
56kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express PRSS16.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express PRSS16.
Immunogen:
The immunogen is a synthetic peptide directed towards the N-terminal region of Human TSSP
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
Complete computational species homology data:
Anti-PRSS16 (ARP42265_P050)
Peptide Sequence:
Synthetic peptide located within the following region: QDGPIFLHLGGEGSLGPGSVMRGHPAALAPAWGALVISLEHRFYGLSIPA
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-PRSS16 (ARP42265_P050) antibody is Catalog # AAP42265
Datasheets/Manuals:
Printable datasheet for anti-PRSS16 (ARP42265_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...