PRR5 Antibody - N-terminal region (ARP56749_P050)

Catalog No: ARP56749_P050

WB Suggested Anti-PRR5 Antibody Titration: 0.2-1 ug/ml
Positive Control: COLO205 cell lysatePRR5 is supported by BioGPS gene expression data to be expressed in COLO205

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PRR5
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: NSIHNGVIAVFQRKGLPDQELFSLNEGVRQLLKTELGSFFTEYLQNQLLT
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-PRR5 (ARP56749_P050) antibody is Catalog # AAP56749 (Previous Catalog # AAPP39607)
• Sample Type Confirmation:

  PRR5 is supported by BioGPS gene expression data to be expressed in COLO205

Target Info

• Gene Symbol: PRR5
• Gene Full Name: Proline rich 5 (renal)
• Alias Symbols: PP610, PROTOR1, PROTOR-1, FLJ20185k
• NCBI Gene Id: 55615
• Protein Name: cDNA FLJ34565 fis, clone KIDNE2006210, highly similar to Homo sapiens proline rich protein 5 (PRR5), transcript variant 1, mRNA EMBL BAG52436.1
• Description of Target: This gene encodes a protein with a proline-rich domain. This gene is located in a region of chromosome 22 reported to contain a tumor suppressor gene that may be involved in breast and colorectal tumorigenesis. Rare read-through transcripts, containing exons from the ARHGAP8 gene which is located immediately downstream, led to the original description of PRR5 and ARHGAP8 as a single gene. Alternative splicing and the use of alternative promoters results in transcripts encoding different isoforms.
• Uniprot ID: B3KRM4
• Protein Accession #: NP_056181
• Nucleotide Accession #: NM_015366
• Protein Size (# AA): 379
• Molecular Weight: 41kDa
• Protein Interactions: MTOR; BRCA1; UBC; RICTOR; MAPKAP1; MLST8;