Search Antibody, Protein, and ELISA Kit Solutions

PRPF4 Antibody - middle region (ARP74151_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Gene Symbol:
PRPF4
Official Gene Full Name:
PRPF4
NCBI Gene Id:
9128
Protein Name:
U4/U6 small nuclear ribonucleoprotein Prp4
Swissprot Id:
O43172
Protein Accession #:
NP_004688.2
Nucleotide Accession #:
NM_001244926.1
Alias Symbols:
PRP4, RP70, HPRP4, Prp4p, HPRP4P, SNRNP60
Description of Target:
The protein encoded by this gene is part of a heteromeric complex that binds U4, U5, and U6 small nuclear RNAs and is involved in pre-mRNA splicing. The encoded protein also is a mitotic checkpoint protein and a regulator of chemoresistance in human ovarian cancer. Two transcript variants encoding different isoforms have been found for this gene.
Protein Size (# AA):
57
Molecular Weight:
522
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express PRPF4.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express PRPF4.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human PRPF4
Tested Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: RERLRNILSVVGTDALKKTKKDDEKSKKSKEEYQQTWYHEGPNSLKVARL
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-PRPF4 (ARP74151_P050) antibody is Catalog # AAP74151
Datasheets/Manuals:
Printable datasheet for anti-PRPF4 (ARP74151_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...