Catalog No: OAAF07433 (Formerly GWB-ASB212)
Size:100 ug
Price: $344.00
SKU
OAAF07433
Availability: Domestic: within 1-2 week delivery | International: 1-2 weeks
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for Progesterone Receptor Antibody (Phospho-Ser400) (OAAF07433)
Product Info
Predicted Species ReactivityHuman|Mouse|Rat
ClonalityPolyclonal
HostRabbit
ApplicationEnzyme-linked immunosorbent assay|Immunocytochemistry|Immunofluorescence|Western blot
Additional InformationModification Sites: Human:S400
Reconstitution and Storage-20°C
ImmunogenThe antiserum was produced against synthesized peptide derived from human Progesterone Receptor around the phosphorylation site of Ser400.
PurificationThe antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.
Peptide SequenceSynthetic peptide located within the following region: DDAYPLYSDFQPPALKIKEEEEGAEASARSPRSYLVAGANPAAFPDFPLG
Concentration1mg/ml
SpecificityProgesterone Receptor (Phospho-Ser400) Antibody detects endogenous levels of Progesterone Receptor only when phosphorylated at Ser400.
FormulationRabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
Application InfoWB: 1:500~1:1000
IF: 1:100~1:500
ELISA: 1:5000
Gene SymbolPGR
Gene Full Nameprogesterone receptor
Alias SymbolsNR3C3;nuclear receptor subfamily 3 group C member 3;PR;progesterone receptor.
NCBI Gene Id5241
Protein NameProgesterone receptor
Description of TargetThe steroid hormones and their receptors are involved in the regulation of eukaryotic gene expression and affect cellular proliferation and differentiation in target tissues. Depending on the isoform, progesterone receptor functions as transcriptional activator or repressor.
Uniprot IDP06401
Molecular Weight98 kDa
  1. What is the species homology for "Progesterone Receptor Antibody (Phospho-Ser400) (OAAF07433)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human|Mouse|Rat".

  2. How long will it take to receive "Progesterone Receptor Antibody (Phospho-Ser400) (OAAF07433)"?

    This item is available "Domestic: within 1-2 week delivery | International: 1-2 weeks".

  3. What buffer format is "Progesterone Receptor Antibody (Phospho-Ser400) (OAAF07433)" provided in?

    This item is provided in "".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "Progesterone Receptor Antibody (Phospho-Ser400) (OAAF07433)"?

    This target may also be called "NR3C3;nuclear receptor subfamily 3 group C member 3;PR;progesterone receptor." in publications.

  5. What is the shipping cost for "Progesterone Receptor Antibody (Phospho-Ser400) (OAAF07433)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "Progesterone Receptor Antibody (Phospho-Ser400) (OAAF07433)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "Progesterone Receptor Antibody (Phospho-Ser400) (OAAF07433)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "98 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "Progesterone Receptor Antibody (Phospho-Ser400) (OAAF07433)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "PGR"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "PGR"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "PGR"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "PGR"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "PGR"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "PGR"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:Progesterone Receptor Antibody (Phospho-Ser400) (OAAF07433)
Your Rating
We found other products you might like!