Search Antibody, Protein, and ELISA Kit Solutions

NOTO Antibody - C-terminal region : FITC (ARP51005_P050-FITC)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP51005_P050 Unconjugated

ARP51005_P050-HRP Conjugated

ARP51005_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Swissprot Id:
Protein Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-168781 from Santa Cruz Biotechnology.
Description of Target:
NOTO is a transcription regulator acting downstream of both FOXA2 and T during notochord development. It is required for node morphogenesis. It is essential for cilia formation in the posterior notochord (PNC) and for left-right patterning; it acts upstream of FOXJ1 and RFX3 in this process and is required for the expression of various components important for axonemal assembly and function. And it plays a role in regulating axial versus paraxial cell fate (By similarity).
Protein Size (# AA):
Molecular Weight:
Affinity purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express NOTO.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express NOTO.
The immunogen is a synthetic peptide directed towards the C-terminal region of Human NOTO
Peptide Sequence:
Synthetic peptide located within the following region: CSGLWAFPDWAPTEDLQDTERQQKRVRTMFNLEQLEELEKVFAKQHNLVG
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
1 mg/ml
Blocking Peptide:
For anti-NOTO (ARP51005_P050-FITC) antibody is Catalog # AAP51005
Printable datasheet for anti-NOTO (ARP51005_P050-FITC) antibody
FITC (FAM): Excitation 495 nm/ Emission 520 nm

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...