Aviva Systems Biology office will be closed for Christmas and New Year Holiday - December 24-25, 2018 and January 1, 2019.
Please go here for more info.

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

Klf4 antibody - N-terminal region (ARP38429_P050)

100 ul
$289.00
In Stock

Conjugation Options

ARP38429_P050-FITC Conjugated

ARP38429_P050-HRP Conjugated

ARP38429_P050-Biotin Conjugated

Gene Symbol:
Klf4
NCBI Gene Id:
16600
Official Gene Full Name:
Kruppel-like factor 4 (gut)
Protein Name:
Krueppel-like factor 4
Swissprot Id:
Q60793
Protein Accession #:
NP_034767
Nucleotide Accession #:
NM_010637
Alias Symbols:
EZF, Gklf, Zie
Replacement Item:
This antibody may replace item sc-114641 from Santa Cruz Biotechnology.
Description of Target:
The function of Klf4 remains unknown.
Protein Size (# AA):
474
Molecular Weight:
51kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express Klf4.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express Klf4.
Immunogen:
The immunogen is a synthetic peptide corresponding to a region of Mouse
Species Reactivity:
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 93%; Horse: 93%; Human: 100%; Mouse: 86%; Pig: 93%; Rabbit: 93%; Rat: 86%; Sheep: 93%
Complete computational species homology data:
Anti-Klf4 (ARP38429_P050)
Peptide Sequence:
Synthetic peptide located within the following region: MRQPPGESDMAVSDALLPSFSTFASGPAGREKTLRPAGAPTNRWREELSH
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Rad21; Smarca4; Tsix; Apc; Pou5f1;
Blocking Peptide:
For anti-Klf4 (ARP38429_P050) antibody is Catalog # AAP38429 (Previous Catalog # AAPP20618)
Datasheets/Manuals:
Printable datasheet for anti-Klf4 (ARP38429_P050) antibody
Average Rating:
1 review
5 star
0
4 star
0
3 star
1
2 star
0
1 star
0
  • Date - Newest First
  • Date - Newest First
  • Date - Latest First
  • Highest Rated
  • Lowest Rated
  • Most Helpful
  • Ownership

1 Item(s)

110/04/2017 17:30
  • Overall Experience:
  • Quality:
Product Review: Klf4 antibody - N-terminal region (ARP38429_P050) in human lung cell line using Western Blot
How do Aviva's reagents play a role in your experimental goals?
Is the first time I am using Aviva's reagents

How would you rate this antibody on a scale from 1-5 (5=best) and why?
3

Would you use this antibody in future experiments?
Maybe

Have you used another antibody which has worked in your application?
Yes, from Abcam

Do you believe the information about the reagent on Aviva's website is correct?
Not totally (unspecific bands not mentioned)

If the antibody works, do you plan to use it in future experiments or to publish your data? Why or why not?
Yes

How did you store the antibody after re-suspension?
Accordingly to manufacture instructions (-20 C)

Sample Description (please include 1) species type, and 2) cell/tissue type, and 3) how much protein loaded for each lane of your gel):
1 - human; 2 - CFBE (lung cell line); 3 - 30, 50, 80 ug

How many different experimental trials were conducted using the antibody sample?
3

How was this sample prepared?
CFBE Cells were washed and resuspended in Laemmli sample buffer and kept at -20 C until loaded

What controls were used in your experiment (positive/negative)?
No controls

Please include your detailed WB Procedure/Protocol here:
Blocking in 5% milk in PBS-Tween, 1h, rt
Primary antibody in 5% milk in PBS-Tween (1:1000 or 1:500), overnight, 4C
Secondary antibody anti-rabbit-HRP in 5% milk in PBS-Tween (1:3000) , 1h, rt

Primary antibody dilution and incubation time:
1 ug/ml (1:2000), 2h rt or overnight 4 C

Secondary antibody used and dilution and incubation time:
anti-rabbit-HRP in 5% milk in PBS-Tween (1:3000), 1 hr rt
Human lung cell line

Submitted by Ana Sofia Cachaco, Faculdade de Ciências da Universidade de Lisboa
0
0
Reply
Show more comments (-2) Hide comments

1 Item(s)

What kind of abuse are you reporting?
    Please, wait...