SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP31688_P050
Price: $0.00
SKU
ARP31688_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-ATF6 (ARP31688_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human ATF6
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 86%; Dog: 79%; Guinea Pig: 93%; Horse: 86%; Human: 100%; Rabbit: 92%; Rat: 79%
Peptide SequenceSynthetic peptide located within the following region: GYFTDTDELQLEAANETYENNFDNLDFDLDLMPWESDIWDINNQICTVKD
Concentration0.5 mg/ml
Blocking PeptideFor anti-ATF6 (ARP31688_P050) antibody is Catalog # AAP31688 (Previous Catalog # AAPP02475)
Sample Type Confirmation

ATF6 is supported by BioGPS gene expression data to be expressed in HeLa

ReferenceKerbiriou,M., Biochim. Biophys. Acta 1772 (11-12), 1236-1249 (2007)
Publications

Exclusion of the unfolded protein response in light-induced retinal degeneration in the canine T4R RHO model of autosomal dominant retinitis pigmentosa. PLoS One. 10, e0115723 (2015). 25695253

Protein kinase R-like endoplasmatic reticulum kinase is a mediator of stretch in ventilator-induced lung injury. Respir Res. 19, 157 (2018). 30134920

Description
Gene SymbolATF6
Gene Full NameActivating transcription factor 6
Alias SymbolsACHM7, ATF6A
NCBI Gene Id22926
Protein NameCyclic AMP-dependent transcription factor ATF-6 alpha
Description of TargetATF6 is an endoplasmic reticulum (ER) stress-regulated transmembrane transcription factor that activates the transcription of ER molecules.ATF6 is an endoplasmic reticulum (ER) stress-regulated transmembrane transcription factor that activates the transcription of ER molecules.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-171 AB015856.1 2-172 172-265 BC014969.1 124-217 266-336 AB015856.1 267-337 337-650 BC014969.1 289-602 651-1294 AF005887.1 626-1269 1295-2406 AB015856.1 1296-2407 2407-2488 AF005887.1 2375-2456
Uniprot IDP18850
Protein Accession #NP_031374
Nucleotide Accession #NM_007348
Protein Size (# AA)670
Molecular Weight74kDa
Protein InteractionsUBC; MAPK14; FBXO6; ATF6; XBP1; NNMT; DDC; BPGM; TNFRSF1A; APP; SP1; SUMO2; SYVN1; WFS1; SREBF2; YY1; NFYC; CREB1; CREB3L3; GTF2I; ATF6B; SRF; NFYA;
  1. What is the species homology for "ATF6 Antibody - N-terminal region (ARP31688_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit".

  2. How long will it take to receive "ATF6 Antibody - N-terminal region (ARP31688_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ATF6 Antibody - N-terminal region (ARP31688_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "ATF6 Antibody - N-terminal region (ARP31688_P050)"?

    This target may also be called "ACHM7, ATF6A" in publications.

  5. What is the shipping cost for "ATF6 Antibody - N-terminal region (ARP31688_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ATF6 Antibody - N-terminal region (ARP31688_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ATF6 Antibody - N-terminal region (ARP31688_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "74kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ATF6 Antibody - N-terminal region (ARP31688_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "ATF6"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ATF6"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ATF6"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ATF6"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ATF6"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ATF6"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ATF6 Antibody - N-terminal region (ARP31688_P050)
Your Rating
We found other products you might like!