Search Antibody, Protein, and ELISA Kit Solutions

NEGR1 antibody - N-terminal region : FITC (ARP55701_P050-FITC)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP55701_P050 Unconjugated

ARP55701_P050-HRP Conjugated

ARP55701_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Neuronal growth regulator 1
Protein Name:
Neuronal growth regulator 1
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
DMML2433, IGLON4, KILON, MGC46680, Ntra
Replacement Item:
This antibody may replace item sc-137625 from Santa Cruz Biotechnology.
Description of Target:
NEGR1 may be involved in cell-adhesion. NEGR1 may function as a trans-neural growth-promoting factor in regenerative axon sprouting in the mammalian brain.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express NEGR1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express NEGR1.
The immunogen is a synthetic peptide directed towards the N terminal region of human NEGR1
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-NEGR1 (ARP55701_P050)
Peptide Sequence:
Synthetic peptide located within the following region: WLNRSSIIFAGGDKWSVDPRVSISTLNKRDYSLQIQNVDVTDDGPYTCSV
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-NEGR1 (ARP55701_P050-FITC) antibody is Catalog # AAP55701 (Previous Catalog # AAPP44438)
Printable datasheet for anti-NEGR1 (ARP55701_P050-FITC) antibody
FITC (FAM): Excitation 495 nm/ Emission 520 nm

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...