Catalog No: ARP63174_P050
Price: $0.00
SKU
ARP63174_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-Prnp (ARP63174_P050) antibody
Product Info
Tested Species ReactivityHuman, Mouse
Predicted Species ReactivityHuman, Rat, Cow, Dog, Goat, Sheep
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB, IHC
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of Mouse Prnp
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Goat: 100%; Human: 100%; Rat: 100%; Sheep: 100%
Peptide SequenceSynthetic peptide located within the following region: GGGTHNQWNKPSKPKTNLKHVAGAAAAGAVVGGLGGYMLGSAMSRPMIHF
Concentration0.5 mg/ml
Blocking PeptideFor anti-Prnp (ARP63174_P050) antibody is Catalog # AAP63174
Gene SymbolPrnp
Gene Full Nameprion protein
Alias SymbolsP, S, PrP, PrPC, Sinc, CD230, PrPSc, Prn-i, Prn-p, PrP, AA960666, AI325101, prP27-30, prP33-35C
NCBI Gene Id19122
Protein NameMajor prion protein
Description of TargetPrnp may play a role in neuronal development and synaptic plasticity, may be required for neuronal myelin sheath maintenance and may play a role in iron uptake and iron homeostasis. Prnp is a soluble oligomers are toxic to cultured neuroblastoma cells and induce apoptosis (in vitro). Association with GPC1 (via its heparan sulfate chains) targets PRNP to lipid rafts. It also provides Cu2+ or ZN2+ for the ascorbate-mediated GPC1 deaminase degradation of its heparan sulfate side chains.
Uniprot IDP04925
Protein Accession #NP_035300
Nucleotide Accession #NM_011170
Protein Size (# AA)254
Molecular Weight28kDa
Protein InteractionsDpp6; Eri3; Syn1; Grb2; Opcml; Lsamp; Ntm; Atp1a3; Igsf8; Cadm3; Clstn1; Pde10a; Adam23; Ywhaz; Ywhae; Stxbp1; Plp1; P4hb; Ncam2; Ncam1; Mog; Mbp; Mag; L1cam; Hspa5; Gnb1; Sparcl1; Dnm1; Dpysl2; Cntn1; Clu; Atp2b2; Atp1b1; Atp1a1; App; Apoe; Aplp2; Apbb1;
  1. What is the species homology for "Prnp Antibody - middle region (ARP63174_P050)"?

    The tested species reactivity for this item is "Human, Mouse". This antibody is predicted to have homology to "Human, Rat, Cow, Dog, Goat, Sheep".

  2. How long will it take to receive "Prnp Antibody - middle region (ARP63174_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "Prnp Antibody - middle region (ARP63174_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "Prnp Antibody - middle region (ARP63174_P050)"?

    This target may also be called "P, S, PrP, PrPC, Sinc, CD230, PrPSc, Prn-i, Prn-p, PrP, AA960666, AI325101, prP27-30, prP33-35C" in publications.

  5. What is the shipping cost for "Prnp Antibody - middle region (ARP63174_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "Prnp Antibody - middle region (ARP63174_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "Prnp Antibody - middle region (ARP63174_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "28kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "Prnp Antibody - middle region (ARP63174_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "PRNP"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "PRNP"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "PRNP"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "PRNP"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "PRNP"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "PRNP"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:Prnp Antibody - middle region (ARP63174_P050)
Your Rating
We found other products you might like!