Search Antibody, Protein, and ELISA Kit Solutions

PRMT7 Antibody - N-terminal region (ARP40191_P050)

100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP40191_P050-FITC Conjugated

ARP40191_P050-HRP Conjugated

ARP40191_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
PRMT7
Official Gene Full Name:
Protein arginine methyltransferase 7
NCBI Gene Id:
54496
Protein Name:
Protein arginine N-methyltransferase 7
Swissprot Id:
Q9NVM4
Protein Accession #:
NP_061896
Nucleotide Accession #:
NM_019023
Alias Symbols:
FLJ10640, KIAA1933
Replacement Item:
This antibody may replace item sc-166819 from Santa Cruz Biotechnology.
Description of Target:
Arginine methylation is an apparently irreversible protein modification catalyzed by arginine methyltransferases, such as PMT7, using S-adenosylmethionine (AdoMet) as the methyl donor. Arginine methylation is implicated in signal transduction, RNA transport, and RNA splicing.Arginine methylation is an apparently irreversible protein modification catalyzed by arginine methyltransferases, such as PMT7, using S-adenosylmethionine (AdoMet) as the methyl donor. Arginine methylation is implicated in signal transduction, RNA transport, and RNA splicing (Miranda et al., 2004 [PubMed 15044439]).[supplied by OMIM].
Protein Size (# AA):
692
Molecular Weight:
78kDa
Purification:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express PRMT7.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express PRMT7.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human PRMT7
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Complete computational species homology data:
Anti-PRMT7 (ARP40191_P050)
Peptide Sequence:
Synthetic peptide located within the following region: MKIFCSRANPTTGSVEWLEEDEHYDYHQEIARSSYADMLHDKDRNVKYYQ
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
SUMO1; H3F3C; ZBTB24; MNDA; UBC; POT1; HHV8GK18_gp81; HIST1H3A; SNRPB; DIO3; CTCFL; HIST1H4A; HIST2H2AC; PIK3CG; PRDM1;
Blocking Peptide:
For anti-PRMT7 (ARP40191_P050) antibody is Catalog # AAP40191 (Previous Catalog # AAPP22037)
Datasheets/Manuals:
Printable datasheet for anti-PRMT7 (ARP40191_P050) antibody
Target Reference:
Gonsalvez,G.B., (2007) J. Cell Biol. 178 (5), 733-740

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...