Search Antibody, Protein, and ELISA Kit Solutions

PRMT6 Antibody - middle region (ARP40190_P050)

100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP40190_P050-FITC Conjugated

ARP40190_P050-HRP Conjugated

ARP40190_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB, CHIP
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-106848 from Santa Cruz Biotechnology.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human PRMT6
Purification:
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Dog: 86%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rat: 100%
Complete computational species homology data:
Anti-PRMT6 (ARP40190_P050)
Peptide Sequence:
Synthetic peptide located within the following region: FRCSCYGSAPMHGFAIWFQVTFPGGESEKPLVLSTSPFHPATHWKQALLY
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-PRMT6 (ARP40190_P050) antibody is Catalog # AAP40190 (Previous Catalog # AAPP22036)
Datasheets/Manuals:
Printable datasheet for anti-PRMT6 (ARP40190_P050) antibody
Target Reference:
Iberg,A.N., (2008) J. Biol. Chem. 283 (6), 3006-3010
Gene Symbol:
PRMT6
Official Gene Full Name:
Protein arginine methyltransferase 6
Alias Symbols:
FLJ10559, HRMT1L6
NCBI Gene Id:
55170
Protein Name:
Protein arginine N-methyltransferase 6
Description of Target:
Protein arginine N-methyltransferases, such as PRMT6, catalyze the sequential transfer of a methyl group from S-adenosyl-L-methionine to the side chain nitrogens of arginine residues within proteins to form methylated arginine derivatives and S-adenosyl-L-homocysteine.Protein arginine N-methyltransferases, such as PRMT6, catalyze the sequential transfer of a methyl group from S-adenosyl-L-methionine to the side chain nitrogens of arginine residues within proteins to form methylated arginine derivatives and S-adenosyl-L-homocysteine.[supplied by OMIM].
Swissprot Id:
A3KME1
Protein Accession #:
NP_060607
Nucleotide Accession #:
NM_018137
Protein Size (# AA):
316
Molecular Weight:
35kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express PRMT6.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express PRMT6.
Protein Interactions:
KIF9; RASSF2; KIAA0408; DNAJA3; AP1G2; HESX1; BLZF1; DNALI1; ZSCAN9; TSC1; TDO2; SUV39H1; SMARCD1; RAD17; RAC1; PSMD11; PEX7; OAS1; NEFL; MNDA; SMAD9; ID2; HOXC4; HOXA5; HOXA1; HNRNPH2; GBE1; FYN; DXO; BMP3; BCAT1; H3F3C; C17orf82; THEMIS; C8orf74; AK8; W

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...