Search Antibody, Protein, and ELISA Kit Solutions

PRMT3 Antibody - middle region (ARP40183_P050)

100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP40183_P050-FITC Conjugated

ARP40183_P050-HRP Conjugated

ARP40183_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB, CHIP
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-130852 from Santa Cruz Biotechnology.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human PRMT3
Purification:
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Dog: 85%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 86%; Rat: 100%
Complete computational species homology data:
Anti-PRMT3 (ARP40183_P050)
Peptide Sequence:
Synthetic peptide located within the following region: LEFSSDFTLKITRTSMCTAIAGYFDIYFEKNCHNRVVFSTGPQSTKTHWK
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-PRMT3 (ARP40183_P050) antibody is Catalog # AAP40183 (Previous Catalog # AAPP22029)
Datasheets/Manuals:
Printable datasheet for anti-PRMT3 (ARP40183_P050) antibody
Target Reference:
Singh,V., (2004) Oncogene 23 (47), 7761-7771
Gene Symbol:
PRMT3
Official Gene Full Name:
Protein arginine methyltransferase 3
Alias Symbols:
HRMT1L3
NCBI Gene Id:
10196
Protein Name:
Protein arginine N-methyltransferase 3
Description of Target:
Type I protein arginine N-methyltransferases (PRMTs), such as PRMT3, catalyze the formation of asymmetric N(G),N(G)-dimethylarginine (ADMA) residues in proteins.Type I protein arginine N-methyltransferases (PRMTs), such as PRMT3, catalyze the formation of asymmetric N(G),N(G)-dimethylarginine (ADMA) residues in proteins (Tang et al., 1998 [PubMed 9642256]).[supplied by OMIM]. Sequence Note: removed 2 bases from the 5' end that did not align to the reference genome assembly. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-2630 BC064831.1 3-2632
Swissprot Id:
O60678
Protein Accession #:
NP_005779
Nucleotide Accession #:
NM_005788
Protein Size (# AA):
531
Molecular Weight:
60kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express PRMT3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express PRMT3.
Protein Interactions:
ARFIP1; SAMHD1; XPO7; FAF1; HSPH1; SEC23A; YAP1; RASSF2; HIRIP3; HIST1H4A; USP11; XRCC5; TROVE2; PPARD; PLOD2; OSBP; NARS; LIG1; IDE; GFPT1; EIF4B; CTNNA1; HNRNPA1; VCP; STAT1; HHV8GK18_gp81; UBC; VHL; TP53; FBL; PABPN1; RPS2;

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...