Search Antibody, Protein, and ELISA Kit Solutions

PRLR Antibody - C-terminal region (ARP80729_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Gene Symbol:
PRLR
Official Gene Full Name:
prolactin receptor
NCBI Gene Id:
5618
Protein Name:
prolactin receptor
Swissprot Id:
P16471
Protein Accession #:
NP_000940.1
Nucleotide Accession #:
NM_000949.6
Alias Symbols:
HPRL, MFAB, hPRLrI
Description of Target:
This gene encodes a receptor for the anterior pituitary hormone, prolactin, and belongs to the type I cytokine receptor family. Prolactin-dependent signaling occurs as the result of ligand-induced dimerization of the prolactin receptor. Several alternatively spliced transcript variants encoding different membrane-bound and soluble isoforms have been described for this gene, which may function to modulate the endocrine and autocrine effects of prolactin in normal tissue and cancer.
Protein Size (# AA):
622
Molecular Weight:
68 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express PRLR.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express PRLR.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human PRLR
Predicted Species Reactivity:
Human
Tested Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: DGALSLLPKQRENSGKPKKPGTPENNKEYAKVSGVMDNNILVLVPDPHAK
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-PRLR (ARP80729_P050) antibody is Catalog # AAP80729
Datasheets/Manuals:
Printable datasheet for anti-PRLR (ARP80729_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...