PRL Recombinant Protein (Pig) (OPCA01798)

Catalog No: OPCA01798

PR Recombinant Protein (Pig) (OPCA01798) in SDS-PAGE showing the molecular weight of approximately 38.9 kDa.

Product Info

• Predicted Species Reactivity: Porcine|Sus scrofa
• Product Format: Liquid or Lyophilized powder
• Host: Pig
• Additional Information: Relevance: Prolactin acts primarily on the mammary gland by promoting lactation.
• Reconstitution and Storage: -20°C or -80°C
• Formulation: 20 mM Tris-HCl based buffer, pH 8.0
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: LPICPSGAVNCQVSLRDLFDRAVILSHYIHNLSSEMFNEFDKRYAQGRGFITKAINSCHTSSLSTPEDKEQAQQIHHEVLLNLILRVLRSWNDPLYHLVTEVRGMQEAPDAILSRAIEIEEQNKRLLEGMEKIVGQVHPGIKENEVYSVWSGLPSLQMADEDTRLFAFYNLLHCLRRDSHKIDNYLKLLKCRIIYDSNC
• Protein Sequence: LPICPSGAVNCQVSLRDLFDRAVILSHYIHNLSSEMFNEFDKRYAQGRGFITKAINSCHTSSLSTPEDKEQAQQIHHEVLLNLILRVLRSWNDPLYHLVTEVRGMQEAPDAILSRAIEIEEQNKRLLEGMEKIVGQVHPGIKENEVYSVWSGLPSLQMADEDTRLFAFYNLLHCLRRDSHKIDNYLKLLKCRIIYDSNC
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: E.coli
• Protein Range: 31-229 aa
• Tag: N-terminal 6xHis-SUMO-tagged

Target Info

• Reference: Nucleotide sequence of porcine preprolactin cDNA.Schulz Aellen M.F., Schmid E., Movva R.N.Nucleic Acids Res. 17:3295-3295(1989)
• Gene Symbol: PRL
• Gene Full Name: prolactin
• Alias Symbols: prolactin.
• NCBI Gene Id: 396965
• Protein Name: Prolactin
• Description of Target: Prolactin acts primarily on the mammary gland by promoting lactation.
• Uniprot ID: P01238
• Protein Accession #: NP_999091.1
  
• Nucleotide Accession #: NM_213926.1
• Protein Size (# AA): Recombinant
• Molecular Weight: 39 kDa