PRKY Antibody - N-terminal region (ARP56441_P050)

Catalog No: ARP56441_P050

WB Suggested Anti-PRKY Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: HepG2 cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PRKY
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Human: 100%
• Peptide Sequence: Synthetic peptide located within the following region: MEAPGPAQAAAAESNSREVTEDAADWAPALCPSPEARSPEAPAYRLQDCD
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-PRKY (ARP56441_P050) antibody is Catalog # AAP56441 (Previous Catalog # AAPP38914)
• Reference: Skaletsky,H., (2003) Nature 423 (6942), 825-837

Target Info

• Gene Symbol: PRKY
• Gene Full Name: Protein kinase, Y-linked, pseudogene
• Alias Symbols: PRKYP, PRKXP3
• NCBI Gene Id: 5616
• Description of Target: This gene is similar to the protein kinase, X-linked gene in the pseudoautosomal region of the X chromsoome. The gene is classified as a transcribed pseudogene because it has lost a coding exon that results in all transcripts being candidates for nonsense
• Uniprot ID: O43930
• Protein Accession #: NP_002751
• Nucleotide Accession #: NM_002760
• Protein Size (# AA): 277
• Molecular Weight: 32kDa
• Protein Interactions: UBC; HSP90AA1;