Catalog No: ARP56626_P050-HRP
Size:100ul
Price: $434.00
SKU
ARP56626_P050-HRP
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

PRKX Antibody - N-terminal region : HRP (ARP56626_P050-HRP)

Datasheets/ManualsPrintable datasheet for anti-PRKX (ARP56626_P050-HRP) antibody
Product Info
ReferenceLi,X., (2008) Biochim. Biophys. Acta 1782 (1), 1-9
Predicted Species ReactivityHuman, Rat
Product FormatLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
ClonalityPolyclonal
HostRabbit
ConjugationHRP: Horseradish Peroxidase
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human PRKX
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceHuman: 100%; Rat: 75%
Peptide SequenceSynthetic peptide located within the following region: MEAPGLAQAAAAESDSRKVAEETPDGAPALCPSPEALSPEPPVYSLQDFD
Concentration0.5 mg/ml
Blocking PeptideFor anti-PRKX (ARP56626_P050-HRP) antibody is Catalog # AAP56626 (Previous Catalog # AAPP39331)
Gene SymbolPRKX
Gene Full NameProtein kinase, X-linked
Alias SymbolsPKX1
NCBI Gene Id5613
Protein NamecAMP-dependent protein kinase catalytic subunit PRKX
Description of TargetThis gene encodes a serine threonine protein kinase that has similarity to the catalytic subunit of cyclic AMP dependent protein kinases. The encoded protein is developmentally regulated and may be involved in renal epithelial morphogenesis. This protein
Uniprot IDP51817
Protein Accession #NP_005035
Nucleotide Accession #NM_005044
Protein Size (# AA)358
Molecular Weight41kDa
Protein InteractionsUBC; HSP90AA1; NEDD4L; NEDD4; PKIA; PRKAR1A; PRKAR2A;
  1. What is the species homology for "PRKX Antibody - N-terminal region : HRP (ARP56626_P050-HRP)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Rat".

  2. How long will it take to receive "PRKX Antibody - N-terminal region : HRP (ARP56626_P050-HRP)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "PRKX Antibody - N-terminal region : HRP (ARP56626_P050-HRP)" provided in?

    This item is provided in "Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "PRKX Antibody - N-terminal region : HRP (ARP56626_P050-HRP)"?

    This target may also be called "PKX1" in publications.

  5. What is the shipping cost for "PRKX Antibody - N-terminal region : HRP (ARP56626_P050-HRP)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "PRKX Antibody - N-terminal region : HRP (ARP56626_P050-HRP)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "PRKX Antibody - N-terminal region : HRP (ARP56626_P050-HRP)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "41kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "PRKX Antibody - N-terminal region : HRP (ARP56626_P050-HRP)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "PRKX"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "PRKX"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "PRKX"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "PRKX"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "PRKX"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "PRKX"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:PRKX Antibody - N-terminal region : HRP (ARP56626_P050-HRP)
Your Rating
We found other products you might like!