Search Antibody, Protein, and ELISA Kit Solutions

PRKRA antibody - middle region (ARP40475_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP40475_P050-FITC Conjugated

ARP40475_P050-HRP Conjugated

ARP40475_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Protein kinase, interferon-inducible double stranded RNA dependent activator
Protein Name:
Interferon-inducible double stranded RNA-dependent protein kinase activator A
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-63342 from Santa Cruz Biotechnology.
Description of Target:
PRKRA contains 3 DRBM (double-stranded RNA-binding) domains. It appears to have a pro-apoptotic function that may be suppressed in the presence of growth factor and activates EIF2AK2 in absence of double stranded RNA (dsRNA).
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express PRKRA.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express PRKRA.
The immunogen is a synthetic peptide directed towards the middle region of human PRKRA
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-PRKRA (ARP40475_P050)
Peptide Sequence:
Synthetic peptide located within the following region: RLPEYTLSQEGGPAHKREYTTICRLESFMETGKGASKKQAKRNAAEKFLA
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-PRKRA (ARP40475_P050) antibody is Catalog # AAP40475 (Previous Catalog # AAPP22243)
Printable datasheet for anti-PRKRA (ARP40475_P050) antibody
Sample Type Confirmation:

PRKRA is supported by BioGPS gene expression data to be expressed in Jurkat

Target Reference:
Lee,Y., (2006) EMBO J. 25 (3), 522-532

Yoshida, K. et al. Interaction between PKR and PACT mediated by LPS-inducible NF-κB in human gingival cells. J. Cell. Biochem. 113, 165-73 (2012). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 21882225

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...