Search Antibody, Protein, and ELISA Kit Solutions

PRKG1 Antibody - C-terminal region (ARP81037_P050)

100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Human
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human PRKG1
Purification:
Affinity purified
Peptide Sequence:
Synthetic peptide located within the following region: FNWEGLRKGTLTPPIIPSVASPTDTSNFDSFPEDNDEPPPDDNSGWDIDF
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-PRKG1 (ARP81037_P050) antibody is Catalog # AAP81037
Datasheets/Manuals:
Printable datasheet for anti-PRKG1 (ARP81037_P050) antibody
Gene Symbol:
PRKG1
Official Gene Full Name:
protein kinase, cGMP-dependent, type I
Alias Symbols:
PKG, cGK, AAT8, cGK1, cGKI, cGK 1, PRKG1B, PRKGR1B, cGKI-BETA, cGKI-alpha
NCBI Gene Id:
5592
Protein Name:
cGMP-dependent protein kinase 1
Description of Target:
Mammals have three different isoforms of cyclic GMP-dependent protein kinase (Ialpha, Ibeta, and II). These PRKG isoforms act as key mediators of the nitric oxide/cGMP signaling pathway and are important components of many signal transduction processes in diverse cell types. This PRKG1 gene on human chromosome 10 encodes the soluble Ialpha and Ibeta isoforms of PRKG by alternative transcript splicing. A separate gene on human chromosome 4, PRKG2, encodes the membrane-bound PRKG isoform II. The PRKG1 proteins play a central role in regulating cardiovascular and neuronal functions in addition to relaxing smooth muscle tone, preventing platelet aggregation, and modulating cell growth. This gene is most strongly expressed in all types of smooth muscle, platelets, cerebellar Purkinje cells, hippocampal neurons, and the lateral amygdala. Isoforms Ialpha and Ibeta have identical cGMP-binding and catalytic domains but differ in their leucine/isoleucine zipper and autoinhibitory sequences and therefore differ in their dimerization substrates and kinase enzyme activity.
Swissprot Id:
Q13976-3
Protein Accession #:
NP_001091982.1
Nucleotide Accession #:
NM_001098512.2
Protein Size (# AA):
389
Molecular Weight:
42 kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express PRKG1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express PRKG1.

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...