Search Antibody, Protein, and ELISA Kit Solutions

PRKD3 Antibody - middle region : FITC (ARP75493_P050-FITC)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP75493_P050 Unconjugated

ARP75493_P050-HRP Conjugated

ARP75493_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
Official Gene Full Name:
protein kinase D3
NCBI Gene Id:
Protein Name:
serine/threonine-protein kinase D3
Swissprot Id:
Protein Accession #:
Alias Symbols:
Description of Target:
This gene belongs to the multigene protein kinase D family of serine/threonine kinases, which bind diacylglycerol and phorbol esters. Members of this family are characterized by an N-terminal regulatory domain comprised of a tandem repeat of cysteine-rich zinc-finger motifs and a pleckstrin domain. The C-terminal region contains the catalytic domain and is distantly related to calcium-regulated kinases. Catalytic activity of this enzyme promotes its nuclear localization. This protein has been implicated in a variety of functions including negative regulation of human airway epithelial barrier formation, growth regulation of breast and prostate cancer cells, and vesicle trafficking.
Protein Size (# AA):
Molecular Weight:
Affinity purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express PRKD3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express PRKD3.
The immunogen is a synthetic peptide directed towards the middle region of Human KPCD3
Predicted Species Reactivity:
Peptide Sequence:
Synthetic peptide located within the following region: VHYTSRDNLRKRHYWRLDSKCLTLFQNESGSKYYKEIPLSEILRISSPRD
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-PRKD3 (ARP75493_P050-FITC) antibody is Catalog # AAP75493
Printable datasheet for anti-PRKD3 (ARP75493_P050-FITC) antibody
FITC (FAM): Excitation 495 nm/ Emission 520 nm
Target Reference:

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...