Size:100 ul
$289.00
In Stock
SKU
ARP75493_P050-FITC
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP75493_P050 Unconjugated

ARP75493_P050-HRP Conjugated

ARP75493_P050-Biotin Conjugated

PRKD3 Antibody - middle region : FITC (ARP75493_P050-FITC)

Catalog#: ARP75493_P050-FITC
Domestic: within 1-2 days delivery | International: 1-2 days
Click here to learn more about Aviva's By-Request Conjugation Service.
More Information
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationFITC (FAM): Excitation 495 nm/ Emission 520 nm
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of Human KPCD3
PurificationAffinity purified
Peptide SequenceSynthetic peptide located within the following region: VHYTSRDNLRKRHYWRLDSKCLTLFQNESGSKYYKEIPLSEILRISSPRD
Concentration0.5 mg/ml
Blocking PeptideFor anti-PRKD3 (ARP75493_P050-FITC) antibody is Catalog # AAP75493
Datasheets/ManualsPrintable datasheet for anti-PRKD3 (ARP75493_P050-FITC) antibody
Target ReferenceN/A
Gene SymbolPRKD3
Official Gene Full Nameprotein kinase D3
Alias SymbolsEPK2, PKD3, PRKCN, PKC-NU, nPKC-NU
NCBI Gene Id23683
Protein Nameserine/threonine-protein kinase D3
Description of TargetThis gene belongs to the multigene protein kinase D family of serine/threonine kinases, which bind diacylglycerol and phorbol esters. Members of this family are characterized by an N-terminal regulatory domain comprised of a tandem repeat of cysteine-rich zinc-finger motifs and a pleckstrin domain. The C-terminal region contains the catalytic domain and is distantly related to calcium-regulated kinases. Catalytic activity of this enzyme promotes its nuclear localization. This protein has been implicated in a variety of functions including negative regulation of human airway epithelial barrier formation, growth regulation of breast and prostate cancer cells, and vesicle trafficking.
Swissprot IdO94806
Protein Accession #XP_005264294
Protein Size (# AA)890
Molecular Weight97kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express PRKD3.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express PRKD3.
Protein InteractionsSKA2; UBC; DLAT; NUDT3; HDAC5; BCL6; IKBKG; RAE1; GSK3A; KPNB1; KPNA2; VAMP2;
Write Your Own Review
You're reviewing:PRKD3 Antibody - middle region : FITC (ARP75493_P050-FITC)
Your Rating
Aviva Tissue Tool
Aviva Validation Data
Aviva Travel Grant
Aviva Tips and Tricks